MIF Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-81832
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human, Mouse, Rat, Hamster
Cited:
Hamster
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNN
Reactivity Notes
Hamster reactivity reported in scientific literature (PMID: 31664114).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for MIF Antibody - BSA Free
Western Blot: MIF Antibody [NBP1-81832]
MIF-Antibody-Western-Blot-NBP1-81832-img0020.jpgImmunocytochemistry/ Immunofluorescence: MIF Antibody [NBP1-81832]
Immunocytochemistry/Immunofluorescence: MIF Antibody [NBP1-81832] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.Immunohistochemistry-Paraffin: MIF Antibody [NBP1-81832]
Immunohistochemistry-Paraffin: MIF Antibody [NBP1-81832] - Staining of human skeletal muscle shows no positivity in myocytes as expected.Western Blot: MIF Antibody [NBP1-81832]
Western Blot: MIF Antibody [NBP1-81832] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.Immunohistochemistry-Paraffin: MIF Antibody [NBP1-81832]
Immunohistochemistry-Paraffin: MIF Antibody [NBP1-81832] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: MIF Antibody [NBP1-81832]
Immunohistochemistry-Paraffin: MIF Antibody [NBP1-81832] - Staining of human kidney moderate cytoplasmic positivity in cells in tubules.Immunohistochemistry-Paraffin: MIF Antibody [NBP1-81832]
Immunohistochemistry-Paraffin: MIF Antibody [NBP1-81832] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.Western Blot: MIF Antibody [NBP1-81832] -
Western Blot: MIF Antibody [NBP1-81832] - Expression & purification of MaMIF. (A) SDS-PAGE analysis of purified MaMIF suggesting an approximate molecular mass of ~12.5 kDa for the monomer. (B) Superdex 75 10/300 GL analytical size-exclusion chromatography profile of MaMIF suggesting an apparent molecular mass of ~39 kDa in solution, corresponding to the size of a trimeric form. (C) CD spectrum of MaMIF confirming a properly folded protein. The pie chart in the inset shows the secondary structure make-up of the protein. (D) Western blot analysis with polyclonal anti-His & anti-MIF antibodies confirming the expressed protein to be MaMIF. (E) Western blot analysis with isotype-matched primary antibody shows the background level of antibody binding to the protein. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31664114), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for MIF Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:2500 - 1:5000
Immunohistochemistry-Paraffin
1:2500 - 1:5000
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: MIF
Long Name
Macrophage Migration Inhibitory Factor
Alternate Names
EC 5.3.2.1, EC 5.3.3.12, GIFmacrophage migration inhibitory factor, GLIF, Glycosylation-inhibiting factor, L-dopachrome isomerase, L-dopachrome tautomerase, macrophage migration inhibitory factor (glycosylation-inhibiting factor), MMIF, Phenylpyruvate tautomerase
Gene Symbol
MIF
Additional MIF Products
Product Documents for MIF Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MIF Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for MIF Antibody - BSA Free
Customer Reviews for MIF Antibody - BSA Free
There are currently no reviews for this product. Be the first to review MIF Antibody - BSA Free and earn rewards!
Have you used MIF Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...