MRP1 Antibody (IU5C1) - BSA Free

Novus Biologicals | Catalog # NB110-57131

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Human

Predicted:

Feline (96%), Primate (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 Clone # IU5C1

Format

BSA Free
Loading...

Product Specifications

Immunogen

A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527]

Epitope

Residues 14-19 (PLWDWN) of the human protein.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Chicken (88%), Bovine (87%), Drosophila melanogaster (72%).

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Theoretical MW

172 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MRP1 Antibody (IU5C1) - BSA Free

Western Blot: MRP1 Antibody (IU5C1)BSA Free [NB110-57131]

Western Blot: MRP1 Antibody (IU5C1)BSA Free [NB110-57131]

Western Blot: MRP1 Antibody (IU5C1) [NB110-57131] - Detection of MRP1 in 10 ug of 293 transfected (lane 2) and empty vector (lane 1) lysate.
Immunocytochemistry/ Immunofluorescence: MRP1 Antibody (IU5C1) - BSA Free [NB110-57131]

Immunocytochemistry/ Immunofluorescence: MRP1 Antibody (IU5C1) - BSA Free [NB110-57131]

Immunocytochemistry/Immunofluorescence: MRP1 Antibody (IU5C1) [NB110-57131] - Staining of MRP1 using NB110-57131 in HEK293 cells with MRP1 expression.
Immunohistochemistry-Paraffin: MRP1 Antibody (IU5C1) - BSA Free [NB110-57131]

Immunohistochemistry-Paraffin: MRP1 Antibody (IU5C1) - BSA Free [NB110-57131]

Immunohistochemistry-Paraffin: MRP1 Antibody (IU5C1) [NB110-57131] - Analysis of a FFPE tissue section of mouse testis using 1:200 dilution of MRP1 [IU5C1] antibody. The staining was developed using HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin.

Applications for MRP1 Antibody (IU5C1) - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

reported in scientific literature

Immunohistochemistry

1:200

Immunohistochemistry-Paraffin

1:200

Western Blot

1:250 - 1:500
Application Notes
This MRP1 antibody is useful for Immunocytochemistry/Immunofluorescence and Western blot analysis on transfected lysate, where a band is seen at ~172 kDa. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Formulation, Preparation, and Storage

Purification

Protein G purified

Formulation

PBS

Format

BSA Free

Preservative

0.1% Sodium Azide

Concentration

1.0 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MRP1

The MRP molecule, an integral membrane glycophosphoprotein belonging to the same superfamily of ATP-binding cassette transmembrane transporter proteins as P-glycoprotein, is overexpressed in many P-glycoprotein-negative, multidrug resistant cell lines and tumours. It is believed that the main function of MRP in drug resistance is that of a plasma membrane drug efflux pump.

Long Name

Multi-drug Resistance Protein 1

Alternate Names

ABCC1, GS-X

Entrez Gene IDs

4363 (Human); 17250 (Mouse)

Gene Symbol

ABCC1

UniProt

Additional MRP1 Products

Product Documents for MRP1 Antibody (IU5C1) - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRP1 Antibody (IU5C1) - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for MRP1 Antibody (IU5C1) - BSA Free

Customer Reviews for MRP1 Antibody (IU5C1) - BSA Free

There are currently no reviews for this product. Be the first to review MRP1 Antibody (IU5C1) - BSA Free and earn rewards!

Have you used MRP1 Antibody (IU5C1) - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

View specific protocols for MRP1 Antibody (IU5C1) - BSA Free (NB110-57131):

Immunohistochemistry-Paraffin Embedded Sections

Antigen Unmasking:
Bring slides to a boil in 10 mM sodium citrate buffer (pH 6.0) then maintain at a sub-boiling temperature for 10 minutes. Cool slides on bench-top for 30 minutes (keep slides in the sodium citrate buffer all the time).

Staining:
1. Wash sections in deionized water three times for 5 minutes each.
2. Wash sections in PBS for 5 minutes.
3. Block each section with 100-400 ul blocking solution (1% BSA in PBS) for 1 hour at room temperature.
4. Remove blocking solution and add 100-400 ul diluted primary antibody. Incubate overnight at 4 C.
5. Remove antibody solution and wash sections in wash buffer three times for 5 minutes each.
6. Add 100-400 ul HRP polymer conjugated secondary antibody. Incubate 30 minutes at room temperature.
7. Wash sections three times in wash buffer for 5 minutes each.
8. Add 100-400 ul DAB substrate to each section and monitor staining closely.
9. As soon as the sections develop, immerse slides in deionized water.
10. Counterstain sections in hematoxylin.
11. Wash sections in deionized water two times for 5 minutes each.
12. Dehydrate sections.
13. Mount coverslips.


Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies