MRP1 Antibody (IU5C1) [CoraFluor™ 1]

Novus Biologicals | Catalog # NB110-57131CL1

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Predicted:

Feline (96%), Primate (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

CoraFluor 1

Antibody Source

Monoclonal Mouse IgG1 Clone # IU5C1
Loading...

Product Specifications

Immunogen

A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527]

Epitope

Residues 14-19 (PLWDWN) of the human protein.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Chicken (88%), Bovine (87%), Drosophila melanogaster (72%).

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Description

CoraFluor(TM) 1 is a high performance terbium-based TR-FRET (Time-Resolved Fluorescence Resonance Energy Transfer) or TRF (Time-Resolved Fluorescence) donor for high throughput assay development. CoraFluor(TM) 1 absorbs UV light at approximately 340 nm, and emits at approximately 490 nm, 545 nm, 585 nm and 620 nm. It is compatible with common acceptor dyes that absorb at the emission wavelengths of CoraFluor(TM) 1. CoraFluor(TM) 1 can be used for the development of robust and scalable TR-FRET binding assays such as target engagement, ternary complex, protein-protein interaction and protein quantification assays.

CoraFluor(TM) 1, amine reactive

CoraFluor(TM) 1, thiol reactive

For more information, please see our CoraFluor(TM) TR-FRET technology flyer.

Scientific Data Images for MRP1 Antibody (IU5C1) [CoraFluor™ 1]

MRP1 Antibody (IU5C1) [CoraFluor™ 1]

Product Feature: CoraFluor Probes for TR-FRET

CoraFluor™ 1, amine reactive (Catalog:7920) and CoraFluor™ 2, amine reactive (Catalog # 7950) are terbium-based probes that have been developed for use as TR-FRET donors. They emit wavelengths compatible with commonly used fluorescent acceptor dyes such as BODIPY® (or BDY) and Janelia Fluor® dyes, FITC (Catalog # 5440), TMR and Cyanine 5 (Catalog # 5436). CoraFluor™ fluorescence is brighter and more stable in biological media than existing TR-FRET donors, leading to enhanced sensitivity and improved data generation. CoraFluor™ 1 exhibits excitation upon exposure to a 337 nm UV laser.

Applications for MRP1 Antibody (IU5C1) [CoraFluor™ 1]

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein G purified

Formulation

PBS

Preservative

No Preservative

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark. Do not freeze.

Background: MRP1

Multidrug Resistance Protein 1 (MRP1) is an integral membrane glycophosphoprotein belonging to the same superfamily of ATP-binding cassette transmembrane transporter proteins as P-glycoprotein. MRP1 is overexpressed in many P-glycoprotein-negative, multidrug resistant cell lines and tumours. It is believed that the main function of MRP in drug resistance is that of a plasma membrane drug efflux pump.

Specifically, MRP1 mediates the export of organic anions and drugs from the cytoplasm. It is through this function, that MRP1 is able to confer resistance to anticancer drugs. MRP1 antibodies are therefore useful tools for cancer testing and research.

Long Name

Multi-drug Resistance Protein 1

Alternate Names

ABCC1, GS-X

Gene Symbol

ABCC1

Additional MRP1 Products

Product Documents for MRP1 Antibody (IU5C1) [CoraFluor™ 1]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRP1 Antibody (IU5C1) [CoraFluor™ 1]

CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for MRP1 Antibody (IU5C1) [CoraFluor™ 1]

There are currently no reviews for this product. Be the first to review MRP1 Antibody (IU5C1) [CoraFluor™ 1] and earn rewards!

Have you used MRP1 Antibody (IU5C1) [CoraFluor™ 1]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies