MRPS35 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82786

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MRPS35 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MRPS35 Antibody - BSA Free

Western Blot: MRPS35 Antibody [NBP1-82786]

Western Blot: MRPS35 Antibody [NBP1-82786]

Western Blot: MRPS35 Antibody [NBP1-82786] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MRPS35 Antibody [NBP1-82786]

Immunocytochemistry/ Immunofluorescence: MRPS35 Antibody [NBP1-82786]

Immunocytochemistry/Immunofluorescence: MRPS35 Antibody [NBP1-82786] - Staining of human cell line A-431 shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786]

Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786]

Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786]

Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786]

Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786]

Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786]

Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786]

Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786]

Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786] - Staining in human kidney and pancreas tissues using anti-MRPS35 antibody. Corresponding MRPS35 RNA-seq data are presented for the same tissues.

Applications for MRPS35 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPS35

MRPS35, or Mitochondrial Ribosomal Protein S35, contains a 37 kDa and a 33 kDa isoform, and is involved in protein synthesis within the mitochondria. The protein is not currently being used in any disease research. MRPS35 has been linked to the DNA damage response and the peptide biosynthetic process, through which it interacts with several other proteins, including ICT1, USP42, UBC, ESR1, and B9D1.

Alternate Names

28S ribosomal protein S28, mitochondrial, DKFZp762P093, MDS023,28S ribosomal protein S35, mitochondrial, MGC104278, mitochondrial ribosomal protein S28, mitochondrial ribosomal protein S35, MRP-S28, MRPS28S35mt, MRP-S35, S28mt

Gene Symbol

MRPS35

Additional MRPS35 Products

Product Documents for MRPS35 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MRPS35 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPS35 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPS35 Antibody - BSA Free and earn rewards!

Have you used MRPS35 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies