MST1/STK4 Antibody (1D7-8A10) - Azide and BSA Free

Novus Biologicals | Catalog # H00006789-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Proximity Ligation Assay

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 1D7-8A10

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

MST1/STK4 (AAH05231, 1 a.a. ~ 39 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEG

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for MST1/STK4 Antibody (1D7-8A10) - Azide and BSA Free

Western Blot: STK4 Antibody (1D7-8A10) [H00006789-M01]

Western Blot: STK4 Antibody (1D7-8A10) [H00006789-M01]

Western Blot: STK4 Antibody (1D7-8A10) [H00006789-M01] - STK4 monoclonal antibody (M01), clone 1D7-8A10 Analysis of STK4 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: STK4 Antibody (1D7-8A10) [H00006789-M01]

Immunocytochemistry/ Immunofluorescence: STK4 Antibody (1D7-8A10) [H00006789-M01]

Immunocytochemistry/Immunofluorescence: STK4 Antibody (1D7-8A10) [H00006789-M01] - Analysis of monoclonal antibody to STK4 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: STK4 Antibody (1D7-8A10) [H00006789-M01]

Immunohistochemistry-Paraffin: STK4 Antibody (1D7-8A10) [H00006789-M01]

Immunohistochemistry-Paraffin: STK4 Antibody (1D7-8A10) [H00006789-M01] - Analysis of monoclonal antibody to STK4 on formalin-fixed paraffin-embedded human stomach carcinoma tissue. Antibody concentration 5 ug/ml.
ELISA: STK4 Antibody (1D7-8A10) [H00006789-M01]

ELISA: STK4 Antibody (1D7-8A10) [H00006789-M01]

ELISA: STK4 Antibody (1D7-8A10) [H00006789-M01] - Detection limit for recombinant GST tagged STK4 is approximately 0.03ng/ml as a capture antibody.

Applications for MST1/STK4 Antibody (1D7-8A10) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Proximity Ligation Assay

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: MST1/STK4

The protein encoded by this gene is a cytoplasmic kinase that is structurally similar to the yeast Ste20p kinase, which acts upstream of the stress-induced mitogen-activated protein kinase cascade. The encoded protein can phosphorylate myelin basic protein and undergoes autophosphorylation. A caspase-cleaved fragment of the encoded protein has been shown to be capable of phosphorylating histone H2B. The particular phosphorylation catalyzed by this protein has been correlated with apoptosis, and it's possible that this protein induces the chromatin condensation observed in this process.

Long Name

Mammalian STE20-like Protein Kinase 1/Serine/Threonine Protein Kinase 4

Alternate Names

KRS2, STK4, YSK3

Entrez Gene IDs

6789 (Human)

Gene Symbol

STK4

OMIM

604965 (Human)

Additional MST1/STK4 Products

Product Documents for MST1/STK4 Antibody (1D7-8A10) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MST1/STK4 Antibody (1D7-8A10) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MST1/STK4 Antibody (1D7-8A10) - Azide and BSA Free

Customer Reviews for MST1/STK4 Antibody (1D7-8A10) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MST1/STK4 Antibody (1D7-8A10) - Azide and BSA Free and earn rewards!

Have you used MST1/STK4 Antibody (1D7-8A10) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...