MSX1 Antibody (1E2) - Azide and BSA Free

Novus Biologicals | Catalog # H00004487-M11

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1E2

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

MSX1 (NP_002439, 216 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions.

Specificity

MSX1 - msh homeobox homolog 1 (Drosophila) (1E2)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for MSX1 Antibody (1E2) - Azide and BSA Free

Western Blot: MSX1 Antibody (1E2) [H00004487-M11]

Western Blot: MSX1 Antibody (1E2) [H00004487-M11]

Western Blot: MSX1 Antibody (1E2) [H00004487-M11] - Analysis of MSX1 expression in Raw 264.7.
Immunocytochemistry/ Immunofluorescence: MSX1 Antibody (1E2) [H00004487-M11]

Immunocytochemistry/ Immunofluorescence: MSX1 Antibody (1E2) [H00004487-M11]

Immunocytochemistry/Immunofluorescence: MSX1 Antibody (1E2) [H00004487-M11] - Analysis of monoclonal antibody to MSX1 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: MSX1 Antibody (1E2) [H00004487-M11]

Western Blot: MSX1 Antibody (1E2) [H00004487-M11]

Western Blot: MSX1 Antibody (1E2) [H00004487-M11] - Analysis of MSX1 expression in U-2 OS.
Immunoprecipitation: MSX1 Antibody (1E2) [H00004487-M11]

Immunoprecipitation: MSX1 Antibody (1E2) [H00004487-M11]

Immunoprecipitation: MSX1 Antibody (1E2) [H00004487-M11] - Analysis of MSX1 transfected lysate using anti-MSX1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MSX1 rabbit polyclonal antibody.
MSX1 Antibody (1E2) - Azide and BSA Free

Western Blot: MSX1 Antibody (1E2) - Azide and BSA Free [H00004487-M11] -

USP11 increases MSX1 protein level. (a) The efficiencies of sgRNA1 and sgRNA2 targeting the USP11 gene and regulating endogenous MSX1 protein levels were determined in hMSCs. (b) The efficiencies of shRNA1 and shRNA2 targeting the USP11 gene and regulating endogenous MSX1 protein levels were determined in hMSCs. (c) hMSCs were transfected with the best sgRNA (sgRNA1) and shRNA (shRNA1) targeting USP11 for the evaluation of endogenous USP11 and MSX1 levels using the respective endogenous antibodies. (d) hMSCs were transfected with an increasing amount of HA-USP11 (0, 1, 2, and 3 ug), and the endogenous expression of MSX1 protein was analyzed using Western blot. The protein band intensities were estimated using ImageJ software with reference to the GAPDH control band (MSX1/GAPDH). (e) hMSCs were transfected with increasing amounts of catalytically inactive HA-USP11CS (0, 1, 2, and 3 ug), and the endogenous expression of MSX1 protein was analyzed using Western blot. The protein band intensities were estimated using ImageJ software with reference to the GAPDH control band (MSX1/GAPDH). (f) Reconstitution effect of USP11 on endogenous MSX1 in USP11-depleted cells. Protein expression was analyzed by Western blotting using the indicated antibodies. GAPDH was used as the loading control. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35055037), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MSX1 Antibody (1E2) - Azide and BSA Free

Western Blot: MSX1 Antibody (1E2) - Azide and BSA Free [H00004487-M11] -

CRISPR-based genome-scale screening of USP sub-family proteins exhibiting a reduction in MSX1 protein levels. (a) Screening for DUBs regulating MSX1 was performed using a CRISPR/Cas9-based DUBKO sgRNA kit. HEK293 cells were transfected with Myc-MSX1 and the indicated sgRNAs along with Cas9. Equal concentrations of proteins from the sgRNA kit transfected HEK293 cells were subjected to Western blot analyses. The protein band intensities were estimated using ImageJ software with reference to the GAPDH control band for each individual sgRNA (Myc-MSX1/GAPDH). The loss of USPs leading to the downregulation of the MSX1 protein level is marked in red. (b) Myc-MSX1, sgRNAs targeting USP11, or sgRNAs targeting USP49 were transfected in HEK293 cells. The protein band intensity of HEK293 cells transfected with sgRNA1 targeting USP11 showed the highest reduction in MSX1. This experiment was performed in triplicates and band intensities were estimated using ImageJ software with reference to the GAPDH control band and are graphically represented. One-way ANOVA followed by Tukey’s post hoc test was used. Error bars represent +/- SD, ** p < 0.001 and *** p < 0.0001. (c) The sgRNAs targeting USP11 or sgRNAs targeting USP49, which potentially regulate endogenous MSX1 protein levels, were transfected in hMSCs along with Cas9. The protein band intensity of hMSCs transfected with sgRNA1 targeting USP11 showed the highest reduction in MSX1. This experiment was performed in triplicates and band intensities were estimated using ImageJ software with reference to the GAPDH control band and are graphically represented. One-way ANOVA followed by Tukey’s post hoc test was used. Error bars represent +/- SD, ** p < 0.001, and *** p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35055037), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MSX1 Antibody (1E2) - Azide and BSA Free

Western Blot: MSX1 Antibody (1E2) - Azide and BSA Free [H00004487-M11] -

CRISPR-based genome-scale screening of USP sub-family proteins exhibiting a reduction in MSX1 protein levels. (a) Screening for DUBs regulating MSX1 was performed using a CRISPR/Cas9-based DUBKO sgRNA kit. HEK293 cells were transfected with Myc-MSX1 and the indicated sgRNAs along with Cas9. Equal concentrations of proteins from the sgRNA kit transfected HEK293 cells were subjected to Western blot analyses. The protein band intensities were estimated using ImageJ software with reference to the GAPDH control band for each individual sgRNA (Myc-MSX1/GAPDH). The loss of USPs leading to the downregulation of the MSX1 protein level is marked in red. (b) Myc-MSX1, sgRNAs targeting USP11, or sgRNAs targeting USP49 were transfected in HEK293 cells. The protein band intensity of HEK293 cells transfected with sgRNA1 targeting USP11 showed the highest reduction in MSX1. This experiment was performed in triplicates and band intensities were estimated using ImageJ software with reference to the GAPDH control band and are graphically represented. One-way ANOVA followed by Tukey’s post hoc test was used. Error bars represent +/- SD, ** p < 0.001 and *** p < 0.0001. (c) The sgRNAs targeting USP11 or sgRNAs targeting USP49, which potentially regulate endogenous MSX1 protein levels, were transfected in hMSCs along with Cas9. The protein band intensity of hMSCs transfected with sgRNA1 targeting USP11 showed the highest reduction in MSX1. This experiment was performed in triplicates and band intensities were estimated using ImageJ software with reference to the GAPDH control band and are graphically represented. One-way ANOVA followed by Tukey’s post hoc test was used. Error bars represent +/- SD, ** p < 0.001, and *** p < 0.0001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35055037), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MSX1 Antibody (1E2) - Azide and BSA Free

Western Blot: MSX1 Antibody (1E2) - Azide and BSA Free [H00004487-M11] -

USP11 increases MSX1 protein level. (a) The efficiencies of sgRNA1 and sgRNA2 targeting the USP11 gene and regulating endogenous MSX1 protein levels were determined in hMSCs. (b) The efficiencies of shRNA1 and shRNA2 targeting the USP11 gene and regulating endogenous MSX1 protein levels were determined in hMSCs. (c) hMSCs were transfected with the best sgRNA (sgRNA1) and shRNA (shRNA1) targeting USP11 for the evaluation of endogenous USP11 and MSX1 levels using the respective endogenous antibodies. (d) hMSCs were transfected with an increasing amount of HA-USP11 (0, 1, 2, and 3 ug), and the endogenous expression of MSX1 protein was analyzed using Western blot. The protein band intensities were estimated using ImageJ software with reference to the GAPDH control band (MSX1/GAPDH). (e) hMSCs were transfected with increasing amounts of catalytically inactive HA-USP11CS (0, 1, 2, and 3 ug), and the endogenous expression of MSX1 protein was analyzed using Western blot. The protein band intensities were estimated using ImageJ software with reference to the GAPDH control band (MSX1/GAPDH). (f) Reconstitution effect of USP11 on endogenous MSX1 in USP11-depleted cells. Protein expression was analyzed by Western blotting using the indicated antibodies. GAPDH was used as the loading control. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35055037), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MSX1 Antibody (1E2) - Azide and BSA Free

Western Blot: MSX1 Antibody (1E2) - Azide and BSA Free [H00004487-M11] -

USP11 increases MSX1 protein level. (a) The efficiencies of sgRNA1 and sgRNA2 targeting the USP11 gene and regulating endogenous MSX1 protein levels were determined in hMSCs. (b) The efficiencies of shRNA1 and shRNA2 targeting the USP11 gene and regulating endogenous MSX1 protein levels were determined in hMSCs. (c) hMSCs were transfected with the best sgRNA (sgRNA1) and shRNA (shRNA1) targeting USP11 for the evaluation of endogenous USP11 and MSX1 levels using the respective endogenous antibodies. (d) hMSCs were transfected with an increasing amount of HA-USP11 (0, 1, 2, and 3 ug), and the endogenous expression of MSX1 protein was analyzed using Western blot. The protein band intensities were estimated using ImageJ software with reference to the GAPDH control band (MSX1/GAPDH). (e) hMSCs were transfected with increasing amounts of catalytically inactive HA-USP11CS (0, 1, 2, and 3 ug), and the endogenous expression of MSX1 protein was analyzed using Western blot. The protein band intensities were estimated using ImageJ software with reference to the GAPDH control band (MSX1/GAPDH). (f) Reconstitution effect of USP11 on endogenous MSX1 in USP11-depleted cells. Protein expression was analyzed by Western blotting using the indicated antibodies. GAPDH was used as the loading control. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35055037), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
MSX1 Antibody (1E2) - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: MSX1 Antibody (1E2) - Azide and BSA Free [H00004487-M11] -

USP11 interacts and deubiquitinates MSX1 protein. (a,b) Interaction between endogenous USP11 and MSX1 proteins was evaluated in hMSCs. Cell lysates from hMSCs were immunoprecipitated with specific MSX1 (a) or USP11 antibodies (b) and immunoblotted with the indicated antibodies. (c) Myc-MSX1 and HA-USP11 were co-transfected in HEK293 cells. Samples were immunoprecipitated using anti-Myc or anti-HA antibodies and immunoblotted using the indicated antibodies. GAPDH was used as a loading control. (d) An immunofluorescence assay was performed to determine the localization of MSX1 and USP11 proteins. DAPI was used as a nuclear stain. (e) The endogenous deubiquitination of MSX1 was analyzed by transfecting hMSCs with Flag-USP11, Flag-USP11CS, and sgRNA targeting USP11, followed by immunoprecipitation with anti-MSX1 antibody and immunoblotting with anti-MSX1 or anti-ubiquitin antibodies. The cells were treated with MG132 for 6 h prior to harvest for all experiments. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35055037), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for MSX1 Antibody (1E2) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: MSX1

This gene encodes a member of the muscle segment homeobox gene family. The encoded protein functions as a transcriptional repressor during embryogenesis through interactions with components of the core transcription complex and other homeoproteins. It may also have roles in limb-pattern formation, craniofacial development, particularly odontogenesis, and tumor growth inhibition. Mutations in this gene, which was once known as homeobox 7, have been associated with nonsyndromic cleft lip with or without cleft palate 5, Witkop syndrome, Wolf-Hirschom syndrome, and autosomoal dominant hypodontia. [provided by RefSeq]

Long Name

Msh Homeobox 1

Alternate Names

HOX7, HYD1, OFC5

Entrez Gene IDs

4487 (Human)

Gene Symbol

MSX1

Additional MSX1 Products

Product Documents for MSX1 Antibody (1E2) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MSX1 Antibody (1E2) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MSX1 Antibody (1E2) - Azide and BSA Free

Customer Reviews for MSX1 Antibody (1E2) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MSX1 Antibody (1E2) - Azide and BSA Free and earn rewards!

Have you used MSX1 Antibody (1E2) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies