MTA2 Antibody (9A5Y7)
Novus Biologicals | Catalog # NBP3-16291
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human
Applications
Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Chromatin Immunoprecipitation (ChIP)
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 9A5Y7 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 569-668 of human MTA2 (O94776). GVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPVPLPAPSHPASTNEPIVLED
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for MTA2 Antibody (9A5Y7)
Western Blot: MTA2 Antibody (9A5Y7) [NBP3-16291]
Western Blot: MTA2 Antibody (9A5Y7) [NBP3-16291] - Western blot analysis of extracts of various cell lines, using MTA2 Rabbit mAb (NBP3-16291) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.Immunohistochemistry-Paraffin: MTA2 Antibody (9A5Y7) [NBP3-16291]
Immunohistochemistry-Paraffin: MTA2 Antibody (9A5Y7) [NBP3-16291] - Immunohistochemistry of paraffin-embedded human colon using MTA2 Rabbit mAb (NBP3-16291) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Chromatin Immunoprecipitation: MTA2 Antibody (9A5Y7) [NBP3-16291] - Chromatin immunoprecipitation analysis of extracts of HeLa cells, using MTA2 antibody (NBP3-16291) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Western Blot: MTA2 Antibody (9A5Y7) [NBP3-16291]
Western Blot: MTA2 Antibody (9A5Y7) [NBP3-16291] - Western blot analysis of extracts of 293T cells, using MTA2 antibody (NBP3-16291) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.Immunohistochemistry-MTA2 Antibody (9A5Y7)-NBP3-16291-
Immunohistochemistry-MTA2 Antibody (9A5Y7)-NBP3-16291-Analysis of U-2 OS using MTA2 antibody at dilution of 1 : 100 (40x lens). Blue: DAPI for nuclear staining.Chromatin Immunoprecipitation: MTA2 Antibody (9A5Y7) [NBP3-16291] -
Chromatin Immunoprecipitation: MTA2 Antibody (9A5Y7) [NBP3-16291] - Chromatin immunoprecipitation analysis of extracts of HeLa cells, using MTA2 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.Applications for MTA2 Antibody (9A5Y7)
Application
Recommended Usage
Chromatin Immunoprecipitation (ChIP)
1:100 - 1:500
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Immunoprecipitation
1:100 - 1:500
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: MTA2
Alternate Names
DKFZp686F2281, metastasis associated 1 family, member 2, metastasis -associated gene 1-like 1, metastasis associated gene family, member 2, Metastasis-associated 1-like 1, metastasis-associated protein 2, metastasis-associated protein MTA2, MTA1-L1 protein, MTA1L1MTA1-L1, p53 target protein in deacetylase complex, PID
Gene Symbol
MTA2
Additional MTA2 Products
Product Documents for MTA2 Antibody (9A5Y7)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MTA2 Antibody (9A5Y7)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for MTA2 Antibody (9A5Y7)
There are currently no reviews for this product. Be the first to review MTA2 Antibody (9A5Y7) and earn rewards!
Have you used MTA2 Antibody (9A5Y7)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ChIP Protocol Video
- Chromatin Immunoprecipitation (ChIP) Protocol
- Chromatin Immunoprecipitation Protocol
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...