mtRNA polymerase Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35578

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all mtRNA polymerase Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 42-230 of human mtRNA polymerase (NP_005026.3).

Sequence:
SSASPQEQDQDRRKDWGHVELLEVLQARVRQLQAESVSEVVVNRVDVARLPECGSGDGSLQPPRKVQMGAKDATPVPCGRWAKILEKDKRTQQMRMQRLKAKLQMPFQSGEFKALTRRLQVEPRLLSKQMAGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

139 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for mtRNA polymerase Antibody - BSA Free

mtRNA polymerase Antibody

Immunocytochemistry/ Immunofluorescence: mtRNA polymerase Antibody [NBP3-35578] -

Immunocytochemistry/ Immunofluorescence: mtRNA polymerase Antibody [NBP3-35578] - Immunofluorescence analysis of U-2 OS cells using mtRNA polymerase Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
mtRNA polymerase Antibody

Western Blot: mtRNA polymerase Antibody [NBP3-35578] -

Western Blot: mtRNA polymerase Antibody [NBP3-35578] - Western blot analysis of various lysates using mtRNA polymerase Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
mtRNA polymerase Antibody

Immunoprecipitation: mtRNA polymerase Antibody [NBP3-35578] -

Immunoprecipitation: mtRNA polymerase Antibody [NBP3-35578] - Immunoprecipitation analysis of 200 ug extracts of HepG2 cells, using 3 ug mtRNA polymerase antibody. Western blot was performed from the immunoprecipitate using mtRNA polymerase antibody at a dilution of 1:1000.
mtRNA polymerase Antibody

Immunocytochemistry/ Immunofluorescence: mtRNA polymerase Antibody [NBP3-35578] -

Immunocytochemistry/ Immunofluorescence: mtRNA polymerase Antibody [NBP3-35578] - Immunofluorescence analysis of C6 cells using mtRNA polymerase Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for mtRNA polymerase Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: mtRNA polymerase

POLRMT, also known as DNA-directed RNA polymerase, mitochondrial, is a 246 amino acid protein that is 28 kDa, catalyzes the transcription of mitochondrial DNA into RNA using the four ribonucleoside triphosphates as substrates. This protein is currently being studied for research on autosomal dominant progressive external ophthalmoplegia, essential thrombocythemia, ophthalmoplegia, immunodeficiency, and malaria. This protein has also shown to have interactions with TFB1M, NFKB2, ICT1, TFB2M, TFAM, and over 200 other proteins in ATP/ITP metabolism, mitochondrial gene expression, transcription from mitochondrial promoters, transcription, RNA polymerase I, RNA polymerase III, and mitochondrial transcription, gene expression, and mitochondrial transcription initiation pathways.

Long Name

DNA-directed RNA polymerase, mitochondrial

Alternate Names

EC 2.7.7.6, MtRPOL, POLRMT

Gene Symbol

POLRMT

Additional mtRNA polymerase Products

Product Documents for mtRNA polymerase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for mtRNA polymerase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for mtRNA polymerase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review mtRNA polymerase Antibody - BSA Free and earn rewards!

Have you used mtRNA polymerase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies