Myoferlin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84694

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Myoferlin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRRMLSNKPQDFQIRVRVIEGRQLSGNNIRPVV

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Myoferlin Antibody - BSA Free

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694]

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694]

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining in human urinary bladder and skeletal muscle tissues using NBP1-84694 antibody. Corresponding MYOF RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: Myoferlin Antibody [NBP1-84694]

Immunocytochemistry/ Immunofluorescence: Myoferlin Antibody [NBP1-84694]

Immunocytochemistry/Immunofluorescence: Myoferlin Antibody [NBP1-84694] - Staining of human cell line U-251 MG shows localization to plasma membrane & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694]

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694]

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining of human placenta shows moderate to strong membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694]

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694]

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining of human prostate shows moderate to strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694]

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694]

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694]

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694]

Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining of human urinary bladder shows strong membranous positivity in urothelial cells.
Simple Western: Myoferlin Antibody [NBP1-84694]

Simple Western: Myoferlin Antibody [NBP1-84694]

Simple Western: Myoferlin Antibody [NBP1-84694] - Lane view shows a specific band for Myoferlin using 200 ug/mL of RT4 cell lysate and 4 ug/mL antibody dilution. Electropherogram image of corresponding Simple Western lane view at WES molecular weight of 222 kDa. Image from an internal validation.
Myoferlin Antibody - BSA Free Western Blot: Myoferlin Antibody - BSA Free [NBP1-84694]

Western Blot: Myoferlin Antibody - BSA Free [NBP1-84694]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Myoferlin Antibody - BSA Free Western Blot: Myoferlin Antibody - BSA Free [NBP1-84694]

Western Blot: Myoferlin Antibody - BSA Free [NBP1-84694]

Analysis in human cell lines A-431 and HEK293 using Anti-MYOF antibody. Corresponding MYOF RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Applications for Myoferlin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Simple Western

1:20

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and NIH-3T3, separated by Size, antibody dilution of 1:20, apparent MW was 220 kDa

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Myoferlin

Myoferlin belongs to the ferlin family and contains five C2 domains. It is a calcium/phospholipid binding protein that plays a role in the plasmalemma repair mechanism of endothelial cells that permits rapid resealing of membranes disrupted by mechanical stress. It is also involved in endocytic recycling and implicated in VEGF signal transduction by regulating the levels of the receptor KDR. Myoferlin is expressed in myoblast and endothelial cells (at protein level), highly expressed in cardiac and skeletal muscles, also present in lung and at very low levels in kidney, placenta and brain. There are eight named isoforms.

Alternate Names

fer-1 (C.elegans)-like 3 (myoferlin), FER1L3, fer-1-like 3, myoferlin, fer-1-like 3, myoferlin (C. elegans), Fer-1-like protein 3, FLJ36571, FLJ90777, KIAA1207, myoferlin

Gene Symbol

MYOF

Additional Myoferlin Products

Product Documents for Myoferlin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Myoferlin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Myoferlin Antibody - BSA Free

Customer Reviews for Myoferlin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Myoferlin Antibody - BSA Free and earn rewards!

Have you used Myoferlin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies