Myosin heavy chain 11 Antibody (0O4O4)

Novus Biologicals | Catalog # NBP3-16323

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0O4O4 expressed in HEK293
View all Myosin heavy chain 11 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1160-1313 of human Myosin heavy chain 11 (NP_002465.1). DSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

227 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Myosin heavy chain 11 Antibody (0O4O4)

Western Blot: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323]

Western Blot: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323]

Western Blot: Myosin heavy chain 11 Antibody (8A8J4) [NBP3-16323] - Western blot analysis of extracts of Mouse lung, using SMMHC/Myosin heavy chain 11 Rabbit mAb (NBP3-16323) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Western Blot: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323]

Western Blot: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323]

Western Blot: Myosin heavy chain 11 Antibody (8A8J4) [NBP3-16323] - Western blot analysis of extracts of Rat lung, using SMMHC/Myosin heavy chain 11 Rabbit mAb (NBP3-16323) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.
Myosin heavy chain 11 Antibody (0O4O4)

Immunohistochemistry: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] -

Immunohistochemistry: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using Myosin heavy chain 11 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Myosin heavy chain 11 Antibody (0O4O4)

Immunocytochemistry/ Immunofluorescence: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] -

Immunocytochemistry/ Immunofluorescence: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] - Confocal imaging of paraffin-embedded Rat small intestine using Myosin heavy chain 11 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.
Myosin heavy chain 11 Antibody (0O4O4)

Immunocytochemistry/ Immunofluorescence: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] -

Immunocytochemistry/ Immunofluorescence: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] - Confocal imaging of paraffin-embedded Human colon using Myosin heavy chain 11 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.
Myosin heavy chain 11 Antibody (0O4O4)

Immunohistochemistry: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] -

Immunohistochemistry: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Myosin heavy chain 11 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Myosin heavy chain 11 Antibody (0O4O4)

Immunohistochemistry: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] -

Immunohistochemistry: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] - Immunohistochemistry analysis of paraffin-embedded Human lung tissue using Myosin heavy chain 11 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Myosin heavy chain 11 Antibody (0O4O4)

Immunohistochemistry: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] -

Immunohistochemistry: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] - Immunohistochemistry analysis of paraffin-embedded Human breast tissue using Myosin heavy chain 11 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Myosin heavy chain 11 Antibody (0O4O4)

Immunohistochemistry: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] -

Immunohistochemistry: Myosin heavy chain 11 Antibody (0O4O4) [NBP3-16323] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Myosin heavy chain 11 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Applications for Myosin heavy chain 11 Antibody (0O4O4)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunocytochemistry/ Immunofluorescence

1:200 - 1:600

Immunohistochemistry

1:500 - 1:5000

Immunohistochemistry-Paraffin

1:500 - 1:5000

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Myosin heavy chain 11

The protein encoded by the MYH11 gene is a smooth muscle myosin belonging to the myosin heavy chain family. The gene product is a subunit of a hexameric protein that consists of two heavy chain subunits and two pairs of non-identical light chain subunits. MYH11 functions as a major contractile protein, converting chemical energy into mechanical energy through the hydrolysis of ATP. The gene encoding a human ortholog of rat NUDE1 is transcribed from the reverse strand of this gene, and its 3' end overlaps with that of the latter. The pericentric inversion of chromosome 16 [inv(16)(p13q22)] produces a chimeric transcript that encodes a protein consisting of the first 165 residues from the N terminus of core-binding factor beta in a fusion with the C-terminal portion of the smooth muscle myosin heavy chain. This chromosomal rearrangement is associated with acute myeloid leukemia of the M4Eo subtype. Alternative splicing generates isoforms that are differentially expressed, with ratios changing during muscle cell maturation. Alternatively spliced transcript variants encoding different isoforms have been identified.

Alternate Names

AAT4, FAA4, MYH11, MYH11 myosin, heavy chain 11, smooth muscle, SMHC, SMMHC, Smooth muscle myosin heavy chain

Gene Symbol

MYH11

Additional Myosin heavy chain 11 Products

Product Documents for Myosin heavy chain 11 Antibody (0O4O4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Myosin heavy chain 11 Antibody (0O4O4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Myosin heavy chain 11 Antibody (0O4O4)

There are currently no reviews for this product. Be the first to review Myosin heavy chain 11 Antibody (0O4O4) and earn rewards!

Have you used Myosin heavy chain 11 Antibody (0O4O4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies