Myosin Light Chain 2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-85541
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human, Mouse
Cited:
Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot
Cited:
IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGE
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 25299188). Rat (82%).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Myosin Light Chain 2 Antibody - BSA Free
Western Blot: Myosin Light Chain 2 Antibody [NBP1-85541]
Western Blot: Myosin Light Chain 2 Antibody [NBP1-85541] - Analysis in human heart tissue.Immunohistochemistry-Frozen: Myosin Light Chain 2 Antibody [NBP1-85541]
Immunohistochemistry-Frozen: Myosin Light Chain 2 Antibody [NBP1-85541] - Mlc2v staining on E11.5 mouse Right Ventricle. Fixed 4% PFA overnight. Blocked with 1% BSA. Primary antibody at 1ug/mL. Secondary antibody at 1:1000, conjugated to Alexa Fluor 488. Image submitted by a verified customer review.Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541]
Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes.Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541]
Immunohistochemistry-Paraffin: Myosin Light Chain 2 Antibody [NBP1-85541] - Staining of human liver shows no positivity in hepatocytes as expected.Immunohistochemistry: Myosin Light Chain 2 Antibody [NBP1-85541]
Immunohistochemistry: Myosin Light Chain 2 Antibody [NBP1-85541] - Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.Immunohistochemistry: Myosin Light Chain 2 Antibody [NBP1-85541]
Immunohistochemistry: Myosin Light Chain 2 Antibody [NBP1-85541] - Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.Applications for Myosin Light Chain 2 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:2500 - 1:5000
Immunohistochemistry-Frozen
Validated from a verified customer review
Immunohistochemistry-Paraffin
1:2500 - 1:5000
Western Blot
0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviewed Applications
Read 1 review rated 5 using NBP1-85541 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Myosin Light Chain 2
Alternate Names
cardiac ventricular myosin light chain 2, CMH10myosin light chain 2, DKFZp779C0562, MLC2, MLC-2, MLC-2v, myosin regulatory light chain 2, ventricular/cardiac muscle isoform, myosin, light chain 2, regulatory, cardiac, slow, myosin, light polypeptide 2, regulatory, cardiac, slow, regulatory light chain of myosin, RLC of myosin, slow cardiac myosin regulatory light chain 2
Gene Symbol
MYL2
Additional Myosin Light Chain 2 Products
Product Documents for Myosin Light Chain 2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Myosin Light Chain 2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Myosin Light Chain 2 Antibody - BSA Free
Customer Reviews for Myosin Light Chain 2 Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used Myosin Light Chain 2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Immunohistochemistry-FrozenSample Tested: E11.5 mouse embryo fixed in 4% PFASpecies: MouseVerified Customer | Posted 01/07/2021Mlc2v staining on E11.5 mouse Right VentricleFixed 4% PFA overnight. Blocked with 1% BSA Primary antibody concentration - 1ug/mL Secondary antibody - Invitrogen Alexa Fluor 488 Secondary antibody - 1:1000
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...