NBR1 Antibody (6B11) - Azide and BSA Free

Novus Biologicals | Catalog # H00004077-M01

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Biological Validation

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Simple Western, Electron Microscopy

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence, Electron Microscopy

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 6B11

Format

Azide and BSA Free
View all NBR1 Primary Antibodies »

Product Specifications

Immunogen

NBR1 (NP_005890, 2 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 23804102). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Specificity

NBR1 - neighbor of BRCA1 gene 1 (6B11)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for NBR1 Antibody (6B11) - Azide and BSA Free

Western Blot: NBR1 Antibody (6B11) [H00004077-M01]

Western Blot: NBR1 Antibody (6B11) [H00004077-M01]

Western Blot: NBR1 Antibody (6B11) [H00004077-M01] - Western Blot analysis of NBR1 expression in PC-12
Immunocytochemistry/ Immunofluorescence: NBR1 Antibody (6B11) [H00004077-M01]

Immunocytochemistry/ Immunofluorescence: NBR1 Antibody (6B11) [H00004077-M01]

NBR1-Antibody-6B11-Immunocytochemistry-Immunofluorescence-H00004077-M01-img0007.jpg
ELISA: NBR1 Antibody (6B11) [H00004077-M01]

ELISA: NBR1 Antibody (6B11) [H00004077-M01]

ELISA: NBR1 Antibody (6B11) [H00004077-M01] - Detection limit for recombinant GST tagged NBR1 is approximately 0.1 ng/mL as a capture antibody.
Simple Western: NBR1 Antibody (6B11) [H00004077-M01]

Simple Western: NBR1 Antibody (6B11) [H00004077-M01]

Simple Western: NBR1 Antibody (6B11) [H00004077-M01] - This antibody (1:25 dilution) was used to probe THP-1 macrophage lysate (concentrations shown) by Simple Western. Results from two hybridoma clones are shown. Simple Western image submitted by a verified customer review.
NBR1 Antibody (6B11)

Western Blot: NBR1 Antibody (6B11) [H00004077-M01] -

Western Blot: NBR1 Antibody (6B11) [H00004077-M01] - G-TPP activity is conserved in primary fibroblasts(A, C) Fibroblasts were treated with 15 µM G-TPP for the indicated time points. Cells were harvested & western blots were probed with antibodies against (A) PINK1, pS65-Ub & total Ub or (C) autophagy adapter proteins. GAPDH & Vinculin served as loading control. G-TPP treatment led to PINK1 stabilization & pS65-Ub induction in primary skin fibroblasts. p62 levels were induced upon G-TPP treatment, while other adapters seemed decreased. (B, D) Human fibroblasts were treated with 15 µM G-TPP for 16 h & fixed & stained with antibodies against (B) pS65-Ub (green) or (D) the autophagy adapters NBR1, NDP52, p62, OPTN & TAX1BP1 (green). Mitochondria were stained with antibodies against TOM20 (red), nuclei were visualized with Hoechst (blue). Scale bars indicate 10 µM. A magnified image of the boxed region, the fluorescence profile along the arrow & the Pearson’s correlation coefficient of adapter protein & mitochondrial stainingare shown to the right. Shown is the mean ± SEM of at least five randomly selected images (unpaired, two-sided t-test, ***p < 0.0005). Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.22287), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NBR1 Antibody (6B11)

Immunocytochemistry/ Immunofluorescence: NBR1 Antibody (6B11) [H00004077-M01] -

Immunocytochemistry/ Immunofluorescence: NBR1 Antibody (6B11) [H00004077-M01] - G-TPP leads to recruitment of autophagy adapters & degradation of mitochondria(A) HeLa cells stably expressing untagged Parkin were treated with 10 µM G-TPP for 8 h. Western blots were prepared from cell lysates & probed with antibodies against LC3, phospho-TBK1 (Ser172) & TBK1. GAPDH was used as a loading control. Upon 8 h the levels of LC3-I & LC3-II were both increased. At 8 h after treatment with G-TPP but not at 4 or 24 h, TBK1 was phosphorylated. (B) HeLa cells stably expressing EGFP-Parkin were treated with 10 µM G-TPP & fixed 8 h after treatment. Cells were stained with antibodies against the autophagy adapter proteins NBR1, NDP52, OPTN, p62, & TAX1BP1 (red). Mitochondria were counterstained with TOM20 antibodies (cyan), nuclei with Hoechst (blue). EGFP-Parkin epifluorescence is shown in green. Scale bar corresponds to 10 µM. (C) HeLa cells stably expressing EGFP-Parkin & the reporter protein mitoKeima were treated with 10 µM CCCP or G-TPP & imaged over time. The ratio of ‘neutral’ mitoKeima to ‘acidic’ mitoKeima was calculated as readout for mitophagy. Parkin translocation was monitored at the same time. Values for Parkin translocation & mitophagy were normalized to 12 h treatment with 10 µM CCCP as positive control & DMSO as negative control (two-way ANOVA with Tukey’s post-hoc test, **p < 0.005, ***p < 0.0005). Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.22287), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NBR1 Antibody (6B11)

Immunocytochemistry/ Immunofluorescence: NBR1 Antibody (6B11) [H00004077-M01] -

Immunocytochemistry/ Immunofluorescence: NBR1 Antibody (6B11) [H00004077-M01] - G-TPP activity is conserved in primary fibroblasts(A, C) Fibroblasts were treated with 15 µM G-TPP for the indicated time points. Cells were harvested & western blots were probed with antibodies against (A) PINK1, pS65-Ub & total Ub or (C) autophagy adapter proteins. GAPDH & Vinculin served as loading control. G-TPP treatment led to PINK1 stabilization & pS65-Ub induction in primary skin fibroblasts. p62 levels were induced upon G-TPP treatment, while other adapters seemed decreased. (B, D) Human fibroblasts were treated with 15 µM G-TPP for 16 h & fixed & stained with antibodies against (B) pS65-Ub (green) or (D) the autophagy adapters NBR1, NDP52, p62, OPTN & TAX1BP1 (green). Mitochondria were stained with antibodies against TOM20 (red), nuclei were visualized with Hoechst (blue). Scale bars indicate 10 µM. A magnified image of the boxed region, the fluorescence profile along the arrow & the Pearson’s correlation coefficient of adapter protein & mitochondrial stainingare shown to the right. Shown is the mean ± SEM of at least five randomly selected images (unpaired, two-sided t-test, ***p < 0.0005). Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.22287), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for NBR1 Antibody (6B11) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 24664425). Use in Electron microscopy reported in scientific literature (PMID: 24664425). This NBR1 Antibody (6B11) is validated for Simple Western from a verified customer review.
See Simple Western Antibody Database for Simple Western validation: Tested in THP-1 macrophage lysate 0.2 mg/mL, 0.6 mg/mL and 1.2 mg/mL, separated by Size, antibody dilution of 1:25

Reviewed Applications

Read 1 review rated 3 using H00004077-M01 in the following applications:

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: NBR1

The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled coil motif, which is present in many genes with transformation potential, but the function of this protein is unknown. This gene is located on a region of chromosome 17q21.1 that is in close proximity to tumor suppressor gene BRCA1. Three alternatively spliced variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Alternate Names

Cell migration-inducing gene 19 protein, FLJ98272, KIAA0049CA125, M17S2FLJ55359,1A1-3B, Membrane component chromosome 17 surface marker 2,1A13B, membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigenCA125), migration-inducing protein 19, neighbor of BRCA1 gene 1, Neighbor of BRCA1 gene 1 protein, next to BRCA1 gene 1 protein, Protein 1A1-3B

Entrez Gene IDs

4077 (Human)

Gene Symbol

NBR1

UniProt

NP_005890 (Human)

Additional NBR1 Products

Product Documents for NBR1 Antibody (6B11) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NBR1 Antibody (6B11) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NBR1 Antibody (6B11) - Azide and BSA Free

Customer Reviews for NBR1 Antibody (6B11) - Azide and BSA Free (1)

3 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
100%
2 Stars
0%
1 Stars
0%

Have you used NBR1 Antibody (6B11) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • NBR1 Antibody (6B11)
    Name: Anonymous
    Application: Simple Western
    Sample Tested: THP-1 macrophage lysate
    Species: Human
    Verified Customer | Posted 12/05/2019
    This antibody (1:25 dilution) was used to probe THP-1 macrophage lysate (concentrations shown) by Simple Western. Results from two hybridoma clones are shown.
    NBR1 Antibody (6B11) - Azide and BSA Free H00004077-M01

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies