NDUFA4L2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-93831

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human NDUFA4L2 (NP_064527.1). MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

10 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NDUFA4L2 Antibody - BSA Free

Western Blot: NDUFA4L2 AntibodyAzide and BSA Free [NBP2-93831]

Western Blot: NDUFA4L2 AntibodyAzide and BSA Free [NBP2-93831]

Western Blot: NDUFA4L2 Antibody [NBP2-93831] - Analysis of extracts of various cell lines, using NDUFA4L2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.
Immunocytochemistry/ Immunofluorescence: NDUFA4L2 Antibody - Azide and BSA Free [NBP2-93831]

Immunocytochemistry/ Immunofluorescence: NDUFA4L2 Antibody - Azide and BSA Free [NBP2-93831]

Immunocytochemistry/Immunofluorescence: NDUFA4L2 Antibody [NBP2-93831] - Immunofluorescence analysis of C6 cells using NDUFA4L2 antibody (NBP2-93831) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: NDUFA4L2 Antibody - Azide and BSA Free [NBP2-93831]

Immunohistochemistry-Paraffin: NDUFA4L2 Antibody - Azide and BSA Free [NBP2-93831]

Immunohistochemistry-Paraffin: NDUFA4L2 Antibody [NBP2-93831] - Mouse kidney using NDUFA4L2 Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunocytochemistry/ Immunofluorescence: NDUFA4L2 Antibody - Azide and BSA Free [NBP2-93831]

Immunocytochemistry/ Immunofluorescence: NDUFA4L2 Antibody - Azide and BSA Free [NBP2-93831]

Immunocytochemistry/Immunofluorescence: NDUFA4L2 Antibody [NBP2-93831] - Analysis of L929 cells using NDUFA4L2 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: NDUFA4L2 Antibody - Azide and BSA Free [NBP2-93831]

Immunocytochemistry/ Immunofluorescence: NDUFA4L2 Antibody - Azide and BSA Free [NBP2-93831]

Immunocytochemistry/Immunofluorescence: NDUFA4L2 Antibody [NBP2-93831] - Analysis of U-2 OS cells using NDUFA4L2 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: NDUFA4L2 Antibody - Azide and BSA Free [NBP2-93831]

Immunohistochemistry-Paraffin: NDUFA4L2 Antibody - Azide and BSA Free [NBP2-93831]

Immunohistochemistry-Paraffin: NDUFA4L2 Antibody [NBP2-93831] - Human colon using NDUFA4L2 Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for NDUFA4L2 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NDUFA4L2

Alternate Names

NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2, NADH:ubiquinone oxidoreductase MLRQ subunit homolog, NADH-ubiquinone oxidoreductase MLRQ subunit homolog, NUOMSFLJ26118

Gene Symbol

NDUFA4L2

Additional NDUFA4L2 Products

Product Documents for NDUFA4L2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NDUFA4L2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for NDUFA4L2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDUFA4L2 Antibody - BSA Free and earn rewards!

Have you used NDUFA4L2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...