NDUFS5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37942

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human NDUFS5 (NP_004543.1).

Sequence:
MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NDUFS5 Antibody - BSA Free

NDUFS5 Antibody

Western Blot: NDUFS5 Antibody [NBP3-37942] -

Western Blot: NDUFS5 Antibody [NBP3-37942] - Western blot analysis of various lysates, using [KD Validated] NDUFS5 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
NDUFS5 Antibody

Immunocytochemistry/ Immunofluorescence: NDUFS5 Antibody [NBP3-37942] -

Immunocytochemistry/ Immunofluorescence: NDUFS5 Antibody [NBP3-37942] - Immunofluorescence analysis of L929 cells using NDUFS5 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NDUFS5 Antibody

Western Blot: NDUFS5 Antibody [NBP3-37942] -

Western Blot: NDUFS5 Antibody [NBP3-37942] - Western Blot analysis of lysates from wild type(WT) and NDUFS5 knockdown (KD) 293T cells, using [KD Validated] NDUFS5 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for NDUFS5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NDUFS5

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Alternate Names

CI-15 kDa, CI15K, CI-15k, Complex I-15 kDa, NADH dehydrogenase (ubiquinone) Fe-S protein 5 (15kD) (NADH-coenzyme Qreductase), NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Qreductase), NADH dehydrogenase [ubiquinone] iron-sulfur protein 5, NADH:ubiquinone oxidoreductase 15 kDa IP subunit, NADH-ubiquinone oxidoreductase 15 kDa subunit

Gene Symbol

NDUFS5

Additional NDUFS5 Products

Product Documents for NDUFS5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NDUFS5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDUFS5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDUFS5 Antibody - BSA Free and earn rewards!

Have you used NDUFS5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...