NECAB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84004

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Rat (98%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunohistochemistry-Frozen

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP

Reactivity Notes

Reactivity in mouse reported in scientific literature (PMID: 24616509)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NECAB1 Antibody - BSA Free

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Analysis in human cerebral cortex and liver tissues. Corresponding NECAB1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human cerebral cortex, colon, liver and pancreas using Anti-NECAB1 antibody NBP1-84004 (A) shows similar protein distribution across tissues to independent antibody NBP1-84003 (B).
Western Blot: NECAB1 Antibody [NBP1-84004]

Western Blot: NECAB1 Antibody [NBP1-84004]

Western Blot: NECAB1 Antibody [NBP1-84004] - Analysis using Anti-NECAB1 antibody NBP1-84004 (A) shows similar pattern to independent antibody NBP1-84003 (B).
Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human pancreas.
Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human liver shows not positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human colon shows no positivityin glandular cells as expected.
Immunohistochemistry: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry: NECAB1 Antibody [NBP1-84004] - Staining of mouse parietal association cortex shows distinct positivity in layer 4 neurons.
Immunohistochemistry: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry: NECAB1 Antibody [NBP1-84004] - Staining of mouse hippocampus shows immunoreactivity in a subset of interneurons.
Immunohistochemistry: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry: NECAB1 Antibody [NBP1-84004] - Staining of mouse superior colliculi shows positivity in a subset of neurons.
Immunohistochemistry: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry: NECAB1 Antibody [NBP1-84004]

Immunohistochemistry: NECAB1 Antibody [NBP1-84004] - Staining of mouse vestibular nucleus shows immunoreactivity in a subset of neurons.
NECAB1 Antibody - BSA Free Immunohistochemistry-Paraffin: NECAB1 Antibody - BSA Free [NBP1-84004]

Immunohistochemistry-Paraffin: NECAB1 Antibody - BSA Free [NBP1-84004]

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Applications for NECAB1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NECAB1

The NECAB1 gene codes for a N-terminal EF-hand calcium-binding protein 1 that in isoform 1 is 351 amino acids long and 40 kDA and in isoform 2 is 100 amino acids long at 11 kDA. NECAB1 has been linked to diseases such as seizures, schizophrenia, alzheimer's disease, motor neuron disease, neuronitis, and neurodegenerative disease.

Alternate Names

EF hand calcium binding protein 1, EFCBP1, EF-hand calcium binding protein 1, EF-hand calcium-binding protein 1, neuronal calcium binding protein, Neuronal calcium-binding protein 1, N-terminal EF-hand calcium binding protein 1, N-terminal EF-hand calcium-binding protein 1, STIP-1, synaptotagmin interacting protein 1

Gene Symbol

NECAB1

Additional NECAB1 Products

Product Documents for NECAB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NECAB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NECAB1 Antibody - BSA Free

Customer Reviews for NECAB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NECAB1 Antibody - BSA Free and earn rewards!

Have you used NECAB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...