NECAB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84005

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NECAB1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PGLLEEDNQWMTQINRLQKLIDRLEKKDLKLEPPEEEIIEGNTKSHIMLVQRQMSVIEEDLEEFQLALKHYVE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NECAB1 Antibody - BSA Free

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005] - Analysis in human cerebral cortex and liver tissues. Corresponding NECAB1 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: NECAB1 Antibody [NBP1-84005]

Immunocytochemistry/ Immunofluorescence: NECAB1 Antibody [NBP1-84005]

Immunocytochemistry/Immunofluorescence: NECAB1 Antibody [NBP1-84005] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005] - Staining of human liver shows no positivity in hepatocytes.
Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005]

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005] - Staining of human colon shows no positivity in glandular cells.
NECAB1 Antibody - BSA Free Immunohistochemistry-Paraffin: NECAB1 Antibody - BSA Free [NBP1-84005]

Immunohistochemistry-Paraffin: NECAB1 Antibody - BSA Free [NBP1-84005]

Staining of human pancreas shows no positivity in exocrine glandular cells.
NECAB1 Antibody - BSA Free Western Blot: NECAB1 Antibody - BSA Free [NBP1-84005]

Western Blot: NECAB1 Antibody - BSA Free [NBP1-84005]

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Mouse Cerebral Cortex tissue
NECAB1 Antibody - BSA Free Western Blot: NECAB1 Antibody - BSA Free [NBP1-84005]

Western Blot: NECAB1 Antibody - BSA Free [NBP1-84005]

Analysis in control (vector only transfected HEK293T lysate) and NECAB1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
NECAB1 Antibody - BSA Free Western Blot: NECAB1 Antibody - BSA Free [NBP1-84005]

Western Blot: NECAB1 Antibody - BSA Free [NBP1-84005]

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Cerebral Cortex tissue

Applications for NECAB1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NECAB1

The NECAB1 gene codes for a N-terminal EF-hand calcium-binding protein 1 that in isoform 1 is 351 amino acids long and 40 kDA and in isoform 2 is 100 amino acids long at 11 kDA. NECAB1 has been linked to diseases such as seizures, schizophrenia, alzheimer's disease, motor neuron disease, neuronitis, and neurodegenerative disease.

Alternate Names

EF hand calcium binding protein 1, EFCBP1, EF-hand calcium binding protein 1, EF-hand calcium-binding protein 1, neuronal calcium binding protein, Neuronal calcium-binding protein 1, N-terminal EF-hand calcium binding protein 1, N-terminal EF-hand calcium-binding protein 1, STIP-1, synaptotagmin interacting protein 1

Gene Symbol

NECAB1

Additional NECAB1 Products

Product Documents for NECAB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NECAB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NECAB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NECAB1 Antibody - BSA Free and earn rewards!

Have you used NECAB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies