NEK3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13650

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: RGGSVIKYSKNTTRKQWLKETPDTLLNILKNADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEED

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NEK3 Antibody - BSA Free

Western Blot: NEK3 Antibody [NBP2-13650]

Western Blot: NEK3 Antibody [NBP2-13650]

Western Blot: NEK3 Antibody [NBP2-13650] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/ Immunofluorescence: NEK3 Antibody [NBP2-13650]

Immunocytochemistry/ Immunofluorescence: NEK3 Antibody [NBP2-13650]

Immunocytochemistry/Immunofluorescence: NEK3 Antibody [NBP2-13650] - Immunofluorescent staining of human cell line HEK 293 shows localization to microtubules.
Immunohistochemistry-Paraffin: NEK3 Antibody [NBP2-13650]

Immunohistochemistry-Paraffin: NEK3 Antibody [NBP2-13650]

Immunohistochemistry-Paraffin: NEK3 Antibody [NBP2-13650] - Staining in human testis and pancreas tissues using anti-NEK3 antibody. Corresponding NEK3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NEK3 Antibody [NBP2-13650]

Immunohistochemistry-Paraffin: NEK3 Antibody [NBP2-13650]

Immunohistochemistry-Paraffin: NEK3 Antibody [NBP2-13650] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: NEK3 Antibody [NBP2-13650]

Immunohistochemistry-Paraffin: NEK3 Antibody [NBP2-13650]

Immunohistochemistry-Paraffin: NEK3 Antibody [NBP2-13650] - Staining of human testis shows high expression.

Applications for NEK3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NEK3

In Aspergillus nidulans, lack of the serine/threonine kinase NimA (never in mitosis A) results in cell cycle arrest in G2, while overexpression causes the premature onset of mitotic events. The protein encoded by this gene is similar in sequence to the Aspergillus nidulans protein and may therefore play a role in mitotic regulation. However, the encoded protein differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. Three transcript variants have been found for this gene, but the full-length nature of only two of them has been characterized.

Alternate Names

EC 2.7.11, EC 2.7.11.1, glycogen synthase A kinase, HSPK 36, HSPK36, hydroxyalkyl-protein kinase, MGC29949, Never in mitosis A-related kinase 3, NIMA (never in mitosis gene a)-related kinase 3, NimA-related protein kinase 3, phosphorylase B kinase kinase, serine/threonine-protein kinase Nek3

Gene Symbol

NEK3

Additional NEK3 Products

Product Documents for NEK3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NEK3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NEK3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NEK3 Antibody - BSA Free and earn rewards!

Have you used NEK3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...