Neogenin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89651

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse, Rat

Predicted:

Rat (98%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGR

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 30333477)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Neogenin Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Neogenin Antibody [NBP1-89651]

Immunocytochemistry/ Immunofluorescence: Neogenin Antibody [NBP1-89651]

Immunocytochemistry/Immunofluorescence: Neogenin Antibody [NBP1-89651] - Staining of human cell line U-2 OS shows localization to nucleoplasm & plasma membrane. Antibody staining shown in green.
Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651]

Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651]

Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651]

Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651]

Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651]

Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651]

Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651]

Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651]

Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651] - Staining of human placenta shows no positivity in trophoblastic cells as expected.
Neogenin Antibody - BSA Free Western Blot: Neogenin Antibody - BSA Free [NBP1-89651]

Western Blot: Neogenin Antibody - BSA Free [NBP1-89651]

Analysis in human cell lines A-549 and HeLa using Anti-NEO1 antibody. Corresponding NEO1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
Neogenin Antibody - BSA Free

Western Blot: Neogenin Antibody - BSA Free [NBP1-89651] -

Expression profiling of spermatogonial stem cell markers in control and neogenin-cKO testes. Neogenin was conditionally knocked out in the mouse testis by CRISPR-Cas9 as described in the Materials and Methods. (A) Quantitative real-time PCR analysis of relative mRNA expression of neogenin, Oct3/4, Sox2, and Nanog normalized against that of beta -actin. (n = 3) (B) Proteins extracted from testicular tissues at postnatal day 26 were analyzed by Western blotting. beta -actin was used as a housekeeping protein. Con: control testis; Neo cKO: neogenin conditional knock-out testis. Data are the mean +/- SD of triplicates. * p < 0.05 and *** p < 0.001 versus control by the Student’s t-test. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36499089), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Neogenin Antibody - BSA Free

Western Blot: Neogenin Antibody - BSA Free [NBP1-89651] -

An ELISA of PGD2 in human follicular fluid and the culture medium of RGMc-treated CCs. (a) The PGD2 level in follicular fluid of patients with a POR and young and old patients with a normal ovarian response. (b,c) The ELISA data of PGD2 level in the culture media of RGMc-treated CCs obtained from (b) patients with a normal ovarian response and (c) patients with a POR. (d) Gene expression of neogenin in human CCs of normal and POR patients. All assays were repeated three times with different samples for statistical analysis. * p < 0.05 and *** p < 0.001 versus the young and old normal ovarian response groups. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33801938), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Neogenin Antibody - BSA Free

Western Blot: Neogenin Antibody - BSA Free [NBP1-89651] -

Involvement of RGMa in the osteogenic transdifferentiation of VSMCs in vitro. (A) Representative images of Alizarin red S staining and magnification. Red is the positive signal of calcification labelled by alizarin. (B) Representative images of RGMa and alpha -SMA immunofluorescence double labelling. alpha -SMA (green); RGMa (red). Scale bar = 50 μm. (C–I) Representative WB images of RGMa, Neogenin and vascular smooth muscle osteogenic transdifferentiation -related markers (C) and quantitative analysis of RGMa (D), Neogenin (E), Runx2 (F), BMP2 (G), alpha -SMA (H), SM22 alpha (I). n=6 per group, ns indicates not significant, *P < 0.05, **P < 0.01, ***P < 0.001, one-way ANOVA. Original blots/gels are available in Supplementary Figure S3. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40634394), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Neogenin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Frozen

Reported in scientific literature (PMID: 30333477)

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Neogenin

Neogenin is one of several netrin-binding proteins. Neogenin functions as an Repulsive Guidance Molecule (RGM) receptor; RGM is implicated in axonal guidance and neural tube closure.

Alternate Names

NEO, NEO1, NGN

Gene Symbol

NEO1

Additional Neogenin Products

Product Documents for Neogenin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Neogenin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Neogenin Antibody - BSA Free

Customer Reviews for Neogenin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Neogenin Antibody - BSA Free and earn rewards!

Have you used Neogenin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...