Neprilysin/CD10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48701

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: STVNISITNEEDVVVYAPEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Neprilysin/CD10 Antibody - BSA Free

Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701]

Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701]

Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701] - Staining of human prostate.
Immunohistochemistry: Neprilysin/CD10 Antibody [NBP2-48701]

Immunohistochemistry: Neprilysin/CD10 Antibody [NBP2-48701]

Immunohistochemistry: Neprilysin/CD10 Antibody [NBP2-48701] - Staining of human small intestine shows membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701]

Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701]

Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701]

Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701]

Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701] - Staining in human small intestine and cerebral cortex tissues using anti-MME antibody. Corresponding MME RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701]

Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701]

Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701] - Staining of human cerebral cortex, kidney, prostate and small intestine using Anti-MME antibody NBP2-48701 (A) shows similar protein distribution across tissues to independent antibody NBP2-49050 (B).
Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701]

Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701]

Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701] - Staining of human kidney.

Applications for Neprilysin/CD10 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Neprilysin/CD10

CD10, also known as the Common Acute Lymphocytic Leukemia Antigen (CALLA), is a cell surface enzyme with neutral metalloendopeptidase activity which inactivates a variety of biologically active peptides. CD10 is expressed on the cells of lymphoblastic, Burkitt's, and follicular germinal center lymphomas, immature B cells with in adult bone marrow and on cells from patients with chronic myelocytic leukemia (CML). CD10 is also present on breast myoepithelial cells, bile canaliculi, fibroblasts, with especially high expression on the brush border of kidney and gut epithelial cells.

Alternate Names

CALLA, CD10, Enkephalinase, Leu-19, MME, Neutral Endopeptidase 24.11, NKH1

Gene Symbol

MME

Additional Neprilysin/CD10 Products

Product Documents for Neprilysin/CD10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Neprilysin/CD10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Neprilysin/CD10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Neprilysin/CD10 Antibody - BSA Free and earn rewards!

Have you used Neprilysin/CD10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies