NFkB p105/p50 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35166

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 740-964 of NFkB p105/p50 (NP_001158884.1).

Sequence:
AAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMATSWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQAHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

105 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NFkB p105/p50 Antibody - BSA Free

NFkB p105/p50 Antibody

Immunohistochemistry: NFkB p105/p50 Antibody [NBP3-35166] -

Immunohistochemistry: NFkB p105/p50 Antibody [NBP3-35166] - Immunohistochemistry analysis of paraffin-embedded Human tonsil using NFkB p105/p50 Rabbit pAb at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
NFkB p105/p50 Antibody

Western Blot: NFkB p105/p50 Antibody [NBP3-35166] -

Western Blot: NFkB p105/p50 Antibody [NBP3-35166] - Western blot analysis of lysates from Raji cells, using NFkB p105/p50 Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
NFkB p105/p50 Antibody

Immunocytochemistry/ Immunofluorescence: NFkB p105/p50 Antibody [NBP3-35166] -

Immunocytochemistry/ Immunofluorescence: NFkB p105/p50 Antibody [NBP3-35166] - Immunofluorescence analysis of MCF7 cells using NFkB p105/p50 Rabbit pAb.Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution.
NFkB p105/p50 Antibody

Immunoprecipitation: NFkB p105/p50 Antibody [NBP3-35166] -

Immunoprecipitation: NFkB p105/p50 Antibody [NBP3-35166] - Immunoprecipitation analysis of 150 ug extracts of MCF-7 cells using 3 ug NFkB p105/p50 antibody. Western blot was performed from the immunoprecipitate using NFkB p105/p50 antibody at a dilution of 1:500.

Applications for NFkB p105/p50 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:20 - 1:100

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NFkB p105/p50

NFkB is a transcription regulator that is activated by various intra and extra cellular stimuli such as cytokines, oxidant free radicals, ultraviolet irradiation, and bacterial or viral products. NFkB is a family of transcription factors that consists of homo and heterodimers of NFkB1/p50 and RelA/p65 subunits, and controls a variety of cellular events including development and immune responses. All members share a conserved amino terminus domain that includes dimerization, nuclear localization, and DNA binding regions, and a carboxy terminal transactivation domain. Serines 529 and 536 in the transactivation domain of RelA/p65 are phosphorylated in response to several stimuli including phorbol ester, IL1 alpha and TNF alpha as mediated by IkB kinase and p38 MAPK. Serine 529 is located in a negatively charged region (amino acids 422-540) that is phosphorylated in response to phorbol myristate acetate plus calcium ionophore activation. Phosphorylation of serines 529 and 536 is critical for RelA/p65 transcriptional activity. Activated NFkB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFkB has been associated with a number of inflammatory diseases while persistent inhibition of NFkB leads to inappropriate immune cell development or delayed cell growth.

Alternate Names

DKFZp686C01211, DNA binding factor KBF1, DNA-binding factor KBF1, EBP-1, KBF1, NF-kappaB, NF-kappa-B, NF-kappabeta, NFKB-p105, NFKB-p50, nuclear factor kappa-B DNA binding subunit, nuclear factor NF-kappa-B p105 subunit, nuclear factor NF-kappa-B p50 subunit, nuclear factor of kappa light polypeptide gene enhancer in B-cells 1MGC54151, p105, p50

Gene Symbol

NFKB1

Additional NFkB p105/p50 Products

Product Documents for NFkB p105/p50 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NFkB p105/p50 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NFkB p105/p50 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NFkB p105/p50 Antibody - BSA Free and earn rewards!

Have you used NFkB p105/p50 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...