NFS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38306

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NFS1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 290-457 of human NFS1 (NP_066923.3).

Sequence:
GMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNGDPKHHYPGCINLSFAYVEGESLLMALKDVALSSGSACTSASLEPSYVLRAIGTDEDLAHSSIRFGIGRFTTEEEVDYTVEKCIQHVKRLREMSPLWEMVQDGIDLKSIKWTQH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NFS1 Antibody - BSA Free

NFS1 Antibody

Immunocytochemistry/ Immunofluorescence: NFS1 Antibody [NBP3-38306] -

Immunocytochemistry/ Immunofluorescence: NFS1 Antibody [NBP3-38306] - Immunofluorescence analysis of L929 cells using NFS1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NFS1 Antibody

Western Blot: NFS1 Antibody [NBP3-38306] -

Western Blot: NFS1 Antibody [NBP3-38306] - Western blot analysis of various lysates using NFS1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.
NFS1 Antibody

Immunocytochemistry/ Immunofluorescence: NFS1 Antibody [NBP3-38306] -

Immunocytochemistry/ Immunofluorescence: NFS1 Antibody [NBP3-38306] - Immunofluorescence analysis of U-251 MG cells using NFS1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NFS1 Antibody

Immunocytochemistry/ Immunofluorescence: NFS1 Antibody [NBP3-38306] -

Immunocytochemistry/ Immunofluorescence: NFS1 Antibody [NBP3-38306] - Immunofluorescence analysis of C6 cells using NFS1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NFS1 Antibody

Immunohistochemistry: NFS1 Antibody [NBP3-38306] -

Immunohistochemistry: NFS1 Antibody [NBP3-38306] - Immunohistochemistry analysis of paraffin-embedded Rat brain using NFS1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for NFS1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NFS1

Iron-sulfur clusters are required for the function of many cellular enzymes. The protein encoded by this gene supplies inorganic sulfur to these clusters by removing the sulfur from cysteine, creating alanine in the process. This gene uses alternate in-frame translation initiation sites to generate mitochondrial forms and cytoplasmic/nuclear forms. Selection of the alternative initiation sites is determined by the cytosolic pH. The encoded protein belongs to the class-V family of pyridoxal phosphate-dependent aminotransferases. [provided by RefSeq]

Alternate Names

cysteine desulfurase, mitochondrial, EC 2.8.1.7, NFS1 nitrogen fixation 1 homolog (S. cerevisiae), NifS, NIFShomolog), nitrogen-fixing bacteria S-like protein

Gene Symbol

NFS1

Additional NFS1 Products

Product Documents for NFS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NFS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NFS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NFS1 Antibody - BSA Free and earn rewards!

Have you used NFS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies