NLRP1/NALP1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-54899
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Rat
Cited:
Human, Mouse, Rat
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to NLRP1(NLR family, pyrin domain containing 1) The peptide sequence was selected from the N terminal of NLRP1 (NP_001028225). DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL. The peptide sequence for this immunogen was taken from within the described region.
Reactivity Notes
Rat reactivity reported in scientific literature (PMID: 30342528)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for NLRP1/NALP1 Antibody - BSA Free
Western Blot: NLRP1/NALP1 Antibody [NBP1-54899]
Western Blot: NLRP1/NALP1 Antibody [NBP1-54899] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.Western Blot: NLRP1/NALP1 Antibody [NBP1-54899] -
Western Blot: NLRP1/NALP1 Antibody [NBP1-54899] Human MCF7 whole cell. Antibody Dilution: 1ug/mlWestern Blot: NLRP1/NALP1 Antibody - BSA Free [NBP1-54899] -
RTP801 silencing in the R6/1 mouse hippocampal neurons reduces the levels of the inflammasome components. (a) Immunoblottings for NLRP1, cleaved NLRP1, procaspase 1, cleaved caspase 1, ASC/TMS1, and GFP as loading control for transduced neurons in the dorsal hippocampus of 4.5-month-old WT shCt, WT shRTP801, R6/1 shCt, and R6/1 shRTP801 mice. (b–f) Densitometric quantification of NRLP1 (treatment effect: F(1, 26) = 24.89, p < 0.0001; interaction: F(1, 26) = 1.175, p = 0.2883), cleaved NLRP1 (treatment effect: F(1, 29) = 44.18, p < 0.0001; genotype effect: F(1, 29) = 15.32, p = 0.0005; interaction: F(1, 29) = 6.588, P = 0.0157), ASC/TMS1 (treatment effect: F(1, 31) = 40.72, p < 0.0001; genotype effect: F(1, 31) = 17.85, p = 0.0002; interaction: F(1, 31) = 15.91, p = 0.0004), procaspase 1 (treatment effect: F(1, 30) = 26.06, p < 0.0001; interaction: F(1, 30) = 10.82, p = 0.0026) and cleaved caspase 1 (treatment effect: F(1, 30) = 25.57, p < 0.0001; interaction: F(1, 30) = 5.551, p = 0.0252) as in (a) for the hippocampus. Densitometric quantification of all proteins is expressed as the mean +/- SEM. All data were analyzed by two-way ANOVA followed by Bonferroni’s post hoc test. * p < 0.05, ** p < 0.01, and *** p < 0.001. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35053183), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for NLRP1/NALP1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:10-1:500
Immunohistochemistry
1:10-1:500
Immunohistochemistry-Frozen
1:10-1:500
Western Blot
1.0 ug/ml
Application Notes
Use in Immunocytochemistry/immunofluorescence and Immunohistochemistry-Frozen reported in scientific literature (PMID 24008734).
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: NLRP1/NALP1
Long Name
NLR Family, Pyrin Domain Containing 1
Alternate Names
CARD7, CLR17.1, DEFCAP, NALP1, PP1044, SLEV1, VAMAS1
Entrez Gene IDs
22861 (Human)
Gene Symbol
NLRP1
UniProt
Additional NLRP1/NALP1 Products
Product Documents for NLRP1/NALP1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for NLRP1/NALP1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for NLRP1/NALP1 Antibody - BSA Free
Customer Reviews for NLRP1/NALP1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review NLRP1/NALP1 Antibody - BSA Free and earn rewards!
Have you used NLRP1/NALP1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...