NONO Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38132

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human NONO (NP_001138881.1).

Sequence:
EGLTIDLKNFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVEPMDQLDDEEGL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NONO Antibody - BSA Free

NONO Antibody

Immunohistochemistry: NONO Antibody [NBP3-38132] -

Immunohistochemistry: NONO Antibody [NBP3-38132] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using NONO Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
NONO Antibody

Immunocytochemistry/ Immunofluorescence: NONO Antibody [NBP3-38132] -

Immunocytochemistry/ Immunofluorescence: NONO Antibody [NBP3-38132] - Immunofluorescence analysis of NIH-3T3 cells using NONO Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NONO Antibody

Immunohistochemistry: NONO Antibody [NBP3-38132] -

Immunohistochemistry: NONO Antibody [NBP3-38132] - Immunohistochemistry analysis of paraffin-embedded Rat lung using NONO Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
NONO Antibody

Immunohistochemistry: NONO Antibody [NBP3-38132] -

Immunohistochemistry: NONO Antibody [NBP3-38132] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using NONO Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
NONO Antibody

Western Blot: NONO Antibody [NBP3-38132] -

Western Blot: NONO Antibody [NBP3-38132] - Western blot analysis of various lysates using NONO Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
NONO Antibody

Immunohistochemistry: NONO Antibody [NBP3-38132] -

Immunohistochemistry: NONO Antibody [NBP3-38132] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using NONO Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
NONO Antibody

Immunocytochemistry/ Immunofluorescence: NONO Antibody [NBP3-38132] -

Immunocytochemistry/ Immunofluorescence: NONO Antibody [NBP3-38132] - Immunofluorescence analysis of C6 cells using NONO Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NONO Antibody

Immunohistochemistry: NONO Antibody [NBP3-38132] -

Immunohistochemistry: NONO Antibody [NBP3-38132] - Immunohistochemistry analysis of paraffin-embedded Rat liver using NONO Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
NONO Antibody

Immunohistochemistry: NONO Antibody [NBP3-38132] -

Immunohistochemistry: NONO Antibody [NBP3-38132] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using NONO Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
NONO Antibody

Immunocytochemistry/ Immunofluorescence: NONO Antibody [NBP3-38132] -

Immunocytochemistry/ Immunofluorescence: NONO Antibody [NBP3-38132] - Immunofluorescence analysis of U-2 OS cells using NONO Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for NONO Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NONO

Non-POU-domain-containing octamer binding protein (NONO) is a member of the DBHS (drosophila behavior, human splicing) domain-containing family and is an RNA- and DNA- binding protein. NONO and other DBHS domain-containing proteins are multifunctional and are reported to be involved in transcriptional regulation, mRNA processing, and DNA non-homologous end joining (NHEJ). NONO functions as a coregulator of the androgen receptor (AR) and also regulates cAMP transcriptional activity by interacting with gene promoter elements. NONO is also involved in pre-mRNA splicing through an interaction with U5 snRNA and can stimulate DNA nonhomologous end joining (NHEJ) through the interaction with ku70/G22p and ku80/XRCC5 dimers. Alternate names for NONO include 54 kDa nuclear RNA- and DNA-binding protein, p54 (nrb), 55 kDa nuclear protein, NMT55, DNA-binding p52/p100 complex, NRB54, P54, and P54NRB.

Alternate Names

NMT5552 kDa subunit, non-POU domain containing, octamer-binding, NRB54non-POU-domain-containing, octamer-binding, p54(nrb)

Gene Symbol

NONO

Additional NONO Products

Product Documents for NONO Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NONO Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NONO Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NONO Antibody - BSA Free and earn rewards!

Have you used NONO Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...