Norrin/NDP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59305

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to NDP(Norrie disease (pseudoglioma)) The peptide sequence was selected from the middle region of NDP. Peptide sequence DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Norrin/NDP Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Norrin/NDP Antibody [NBP1-59305]

Immunocytochemistry/ Immunofluorescence: Norrin/NDP Antibody [NBP1-59305]

Norrin-NDP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-59305-img0005.jpg
Western Blot: Norrin/NDP Antibody [NBP1-59305]

Western Blot: Norrin/NDP Antibody [NBP1-59305]

Western Blot: NDP/Norrin Antibody [NBP1-59305] - Fetal Liver tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry-Paraffin: Norrin/NDP Antibody [NBP1-59305]

Immunohistochemistry-Paraffin: Norrin/NDP Antibody [NBP1-59305]

Immunohistochemistry-Paraffin: NDP/Norrin Antibody [NBP1-59305] - Human Brain, cortex tissue at an antibody concentration of 5ug/ml.
Norrin/NDP Antibody

Immunocytochemistry/ Immunofluorescence: Norrin/NDP Antibody [NBP1-59305] -

Immunocytochemistry/ Immunofluorescence: Norrin/NDP Antibody [NBP1-59305] - Staining of vascular BM whole mounts with antibodies to proteins detected in the proteome analysis.A generic staining of the vascular BMs was given by an antibody to the 7S domain of collagen IV alpha 3 (A, C, E, F, G). Prominent staining for microvascular aneurisms was detected by staining with antibodies to C9 (B, C), Fibronectin (FN, E), ApoE (F) & PRELP (G). The same treatment of vascular BM whole mounts from non-diabetic eyes did not show staining for these proteins (D). A norrin-specific staining is shown to be generic for the entire vascular BM whole mounts (H), the signal, however, being less prominent in vascular aneurisms (arrow in H). Staining of vascular BM whole mounts from non-diabetic eyes showed a clearly weaker staining for norrin, when compared to vascular whole mounts from non-diabetic donors. Bar: 25um. Image collected & cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0189857), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Norrin/NDP Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

2-5 ug/ml

Western Blot

1.0 ug/ml
Application Notes
Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID : 29284024).

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Norrin

NDP activates the canonical Wnt signaling pathway through FZD4 and LRP5 coreceptor. NDP plays a central role in retinal vascularization by acting as a ligand for FZD4 that signals via stabilizing beta-catenin (CTNNB1) and activating LEF/TCF-mediated transcriptional programs. NDP acts in concert with TSPAN12 to activate FZD4 independently of the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1). NDP may be involved in a pathway that regulates neural cell differentiation and proliferation. NDP is the genetic locus identified as harboring mutations that result in Norrie disease. Norrie disease is a rare genetic disorder characterized by bilateral congenital blindness that is caused by a vascularized mass behind each lens due to a maldeveloped retina (pseudoglioma). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-94 AL034370.1 53727-53820 c 95-1761 X65882.1 1-1667 1762-1935 BE139596.1 1-174 c

Alternate Names

NDP

Gene Symbol

NDP

UniProt

Additional Norrin Products

Product Documents for Norrin/NDP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Norrin/NDP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for Norrin/NDP Antibody - BSA Free

Customer Reviews for Norrin/NDP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Norrin/NDP Antibody - BSA Free and earn rewards!

Have you used Norrin/NDP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...