NSFL1C Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13677

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: EEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NSFL1C Antibody - BSA Free

Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677]

Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677]

Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-NSFL1C antibody NBP2-13677 (A) shows similar protein distribution across tissues to independent antibody NBP2-13676 (B).
Western Blot: NSFL1C Antibody [NBP2-13677]

Western Blot: NSFL1C Antibody [NBP2-13677]

NSFL1C-Antibody-Western-Blot-NBP2-13677-img0011.jpg
Immunocytochemistry/ Immunofluorescence: NSFL1C Antibody [NBP2-13677]

Immunocytochemistry/ Immunofluorescence: NSFL1C Antibody [NBP2-13677]

Immunocytochemistry/Immunofluorescence: NSFL1C Antibody [NBP2-13677] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677]

Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677]

Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human testis.
Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677]

Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677]

Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human kidney.
Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677]

Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677]

Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677]

Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677]

Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13677] - Staining of human lymph node.
NSFL1C Antibody

Western Blot: NSFL1C Antibody [NBP2-13677] -

Western Blot: NSFL1C Antibody [NBP2-13677] - Analysis in human cell line A-549.
NSFL1C Antibody

Western Blot: NSFL1C Antibody [NBP2-13677] -

Western Blot: NSFL1C Antibody [NBP2-13677] - PINK1 phosphorylates the activation loop of PKA. A, IP products of HEK293 cell lysates expressing GFP or PINK1-GFP reveal that PINK1 pulls down the PKA holoenzyme (PKAcat & PKAreg) in addition to VCP & p47. B, IP products of HEK293 lysates expressing PINK1-GFP, GFP or GFP-VCP reveal that either PINK1 or VCP pull down p47, but only PINK1 pulls down PKAreg. C, IP products of HEK293 lystates expressing Vector or MYC-p47 reveals that p47 does not interact w/ PKAcat or PKAreg. D, 2-D analysis of endogenous PKA subunits in control (M14) & PINK1-3xFlag (#24) stable SH-SY5Y lines reveal an acidic shift of PKAcat (arrow), but not PKAreg, in PINK1-overexpressing cells. E, Structural model for the MD-equilibrated (100 ns) complex between hPINK1 (pink) & PKAcat (green). PKA-T197 (cyan balls) & PINK1-D362 (orange balls) are shown in relation to PINK1-bound ATP w/ two Mg2+ (purple). Red, tan, white, cyan, & blue represent O, P, H, C, & N atoms, respectively, of ATP. F, Immunoblot analysis of HEK293 cells transfected w/ GFP or PINK1-GFP reveals that PINK1-GFP increases PKAcat phosphorylation at T197, but has no effect on PKAreg phosphorylation at S99 (mean ± SD, three independent experiments, p = 0.014). G, Recombinant PKAcat purified from E. coli, which is already phosphorylated at T197, dephosphorylated by incubation w/ lambda phosphatase (PP) at 30°C × 1 h. Successful dephosphorylation verified by immunoblot. H, In vitro kinase assay of human GST-PINK1 w/ dephosphorylated recombinant PKAcat in the presence or absence of the PKA inhibitor H89 reveals that hPINK1 phosphorylates PKA at T197. I, In vitro kinase assay of GST-TcPINK1 w/ dephosphorylated recombinant PKAcat reveals that TcPINK1 is also capable of directly phosphorylating PKAcat. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30783609), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
NSFL1C Antibody

Western Blot: NSFL1C Antibody [NBP2-13677] -

Western Blot: NSFL1C Antibody [NBP2-13677] - PINK1 phosphorylates the activation loop of PKA. A, IP products of HEK293 cell lysates expressing GFP or PINK1-GFP reveal that PINK1 pulls down the PKA holoenzyme (PKAcat & PKAreg) in addition to VCP & p47. B, IP products of HEK293 lysates expressing PINK1-GFP, GFP or GFP-VCP reveal that either PINK1 or VCP pull down p47, but only PINK1 pulls down PKAreg. C, IP products of HEK293 lystates expressing Vector or MYC-p47 reveals that p47 does not interact w/ PKAcat or PKAreg. D, 2-D analysis of endogenous PKA subunits in control (M14) & PINK1-3xFlag (#24) stable SH-SY5Y lines reveal an acidic shift of PKAcat (arrow), but not PKAreg, in PINK1-overexpressing cells. E, Structural model for the MD-equilibrated (100 ns) complex between hPINK1 (pink) & PKAcat (green). PKA-T197 (cyan balls) & PINK1-D362 (orange balls) are shown in relation to PINK1-bound ATP w/ two Mg2+ (purple). Red, tan, white, cyan, & blue represent O, P, H, C, & N atoms, respectively, of ATP. F, Immunoblot analysis of HEK293 cells transfected w/ GFP or PINK1-GFP reveals that PINK1-GFP increases PKAcat phosphorylation at T197, but has no effect on PKAreg phosphorylation at S99 (mean ± SD, three independent experiments, p = 0.014). G, Recombinant PKAcat purified from E. coli, which is already phosphorylated at T197, dephosphorylated by incubation w/ lambda phosphatase (PP) at 30°C × 1 h. Successful dephosphorylation verified by immunoblot. H, In vitro kinase assay of human GST-PINK1 w/ dephosphorylated recombinant PKAcat in the presence or absence of the PKA inhibitor H89 reveals that hPINK1 phosphorylates PKA at T197. I, In vitro kinase assay of GST-TcPINK1 w/ dephosphorylated recombinant PKAcat reveals that TcPINK1 is also capable of directly phosphorylating PKAcat. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30783609), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for NSFL1C Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000-1:2500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NSFL1C

N-ethylmaleimide-sensitive factor (NSF) and valosin-containing protein (p97) are two ATPases known to be involved in transport vesicle/target membrane fusion and fusions between membrane compartments. A trimer of the protein encoded by this gene binds a hexamer of cytosolic p97 and is required for p97-mediated regrowth of Golgi cisternae from mitotic Golgi fragments. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

dJ776F14.1, NSFL1 (p97) cofactor (p47), NSFL1 cofactor p47, p47, p97 cofactor p47, SHP1 homolog, UBX domain protein 2C, UBX domain-containing protein 2C, UBX1, UBXD10, UBXN2CMGC3347

Gene Symbol

NSFL1C

Additional NSFL1C Products

Product Documents for NSFL1C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NSFL1C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NSFL1C Antibody - BSA Free

Customer Reviews for NSFL1C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NSFL1C Antibody - BSA Free and earn rewards!

Have you used NSFL1C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...