NUAK2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-81880
Loading...
Key Product Details
Validated by
Knockout/Knockdown, Biological Validation
Species Reactivity
Validated:
Human
Cited:
Human, Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DPKEQKPPQASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT
Reactivity Notes
Rat (81%). Use in Mouse reported in scientific literature (PMID:31350328).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for NUAK2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: NUAK2 Antibody [NBP1-81880]
Immunocytochemistry/Immunofluorescence: NUAK2 Antibody [NBP1-81880] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nucleoli fibrillar center & cytosol. Antibody staining is shown in green.Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880]
Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880] - Staining of human testis shows moderate to strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.Western Blot: NUAK2 Antibody [NBP1-81880]
Western Blot: NUAK2 Antibody [NBP1-81880] - Analysis in control (vector only transfected HEK293T lysate) and NUAK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880]
Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880] - Staining of human cerebellum shows strong membranous positivity in Purkinje cells.Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880]
Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880] - Staining of human cervix shows strong nuclear positivity in squamous epithelial cells.Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880]
Immunohistochemistry-Paraffin: NUAK2 Antibody [NBP1-81880] - Staining of human duodenum shows moderate to strong nuclear positivity in glandular cells.Western Blot: NUAK2 Antibody [NBP1-81880] -
Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 activity is involved in serum-induced or LPA-induced YAP/TAZ dephosphorylation & activation. a, b FBS & LPA activate YAP/TAZ & induce NUAK2 expression. YAP/TAZ phosphorylation status was monitored using Phos-Tag gels (a), while NUAK2 & ANKRD1 mRNA expression was determined by qPCR at the indicated times. Expression data are plotted as the mean ± SD (n = 3). c–h WZ4003 (10 μM) blocks serum/LPA-induced NUAK2 & ANKRD1 mRNA expression. FBS-induced or LPA-induced YAP/TAZ dephosphorylation (e & g), or NUAK2 & ANKRD1 mRNA expression (c, f, h) was monitored at the indicated times (d). Expression data are plotted as the mean ± range for a representative experiment (c, f, h) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: NUAK2 Antibody [NBP1-81880] -
Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 regulates YAP/TAZ activity through LATS. a Loss of NUAK2 enhances YAP/TAZ phosphorylation in MDA-MB231 cells. Quantitation of relative phosphorylation levels from blots is shown. b NUAK2 interacts with LATS1 & LATS2, but not MST1, MST2, or TAZ in the LUMIER protein interaction screen. c Lysates from HEK293T cells, transfected with NUAK2-Flag, were subjected to immunoprecipitation (IP) using anti-LATS1 antibody for endogenous LATS1 & co-immunoprecipitated NUAK2-Flag was detected by immunoblotting. Protein expression levels were confirmed (Totals). WT wild type, KR K81R, kinase dead. d–f NUAK2 requires LATS to regulate YAP/TAZ localization, phosphorylation, & target gene expression in MDA-MB231 cells. d YAP/TAZ localization was quantitated & plotted as the mean ± SD (n = 3) with representative images shown on the right. Scale bars, 25 μm. N: nuclear, C: cytoplasmic. e Target gene expression was determined by qPCR. Data are plotted as the mean ± SD (n = 3). f YAP/TAZ phosphorylation was monitored using Phos-Tag gels. Relative phosphorylation levels from blots is quantitated (right) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: NUAK2 Antibody [NBP1-81880] -
Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 regulates YAP/TAZ activity through LATS. a Loss of NUAK2 enhances YAP/TAZ phosphorylation in MDA-MB231 cells. Quantitation of relative phosphorylation levels from blots is shown. b NUAK2 interacts with LATS1 & LATS2, but not MST1, MST2, or TAZ in the LUMIER protein interaction screen. c Lysates from HEK293T cells, transfected with NUAK2-Flag, were subjected to immunoprecipitation (IP) using anti-LATS1 antibody for endogenous LATS1 & co-immunoprecipitated NUAK2-Flag was detected by immunoblotting. Protein expression levels were confirmed (Totals). WT wild type, KR K81R, kinase dead. d–f NUAK2 requires LATS to regulate YAP/TAZ localization, phosphorylation, & target gene expression in MDA-MB231 cells. d YAP/TAZ localization was quantitated & plotted as the mean ± SD (n = 3) with representative images shown on the right. Scale bars, 25 μm. N: nuclear, C: cytoplasmic. e Target gene expression was determined by qPCR. Data are plotted as the mean ± SD (n = 3). f YAP/TAZ phosphorylation was monitored using Phos-Tag gels. Relative phosphorylation levels from blots is quantitated (right) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: NUAK2 Antibody [NBP1-81880] -
Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 is associated with high-grade human bladder cancer. a, c Expression of NUAK2 & the YAP Signature Genes (YAP SG) is enhanced both in high-grade non-muscle-invasive (HG-NMIBC; n = 13, **p = 0.0071) & muscle-invasive (pT2 MIBC; n = 9, **p = 0.0033) bladder cancers39 as compared to LG-NMIBC (n = 27) using an unpaired t test. b Elevated expression of NUAK2 is correlated with disease recurrence in a cohort41 of MIBC patient samples with n = 57 disease free & n = 56, recurred samples (*p = 0.0172). Box & whisker plots show the median (line in the box), first & third quartiles (lower & upper ends of the box), & the minimum & maximum values (whiskers in the plot). Dots represent a single patient sample. d A heat map depicting expression of NUAK2 & YAP SG in NMIBC LG (open circle), HG (closed circle), & MIBC pT2 (slashed circle) bladder cancer samples39. e Characterization of high-grade-derived & low-grade-derived bladder cancer cell lines. Scale bar, 25 μm. f NUAK2 mRNA expression is elevated in HG-derived (TCCSUP & T24) BC cell lines as compared to LG lines. Data are plotted as the mean ± SD (n = 3). g–i Blocking NUAK2 activity with 10 μM WZ4003 (g) or NUAK2 expression in stable clones (#5 or #7) using inducible NUAK2 shRNAs (h, i) inhibits the growth of HG BC cell lines as measured by SRB (g) or DAPI (h) staining. Data are plotted as the mean ± SD of a representative experiment, n = 3 (for TCC) or mean ± range of two experiments (for T24) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: NUAK2 Antibody [NBP1-81880] -
Western Blot: NUAK2 Antibody [NBP1-81880] - NUAK2 regulates YAP/TAZ activity through LATS. a Loss of NUAK2 enhances YAP/TAZ phosphorylation in MDA-MB231 cells. Quantitation of relative phosphorylation levels from blots is shown. b NUAK2 interacts with LATS1 & LATS2, but not MST1, MST2, or TAZ in the LUMIER protein interaction screen. c Lysates from HEK293T cells, transfected with NUAK2-Flag, were subjected to immunoprecipitation (IP) using anti-LATS1 antibody for endogenous LATS1 & co-immunoprecipitated NUAK2-Flag was detected by immunoblotting. Protein expression levels were confirmed (Totals). WT wild type, KR K81R, kinase dead. d–f NUAK2 requires LATS to regulate YAP/TAZ localization, phosphorylation, & target gene expression in MDA-MB231 cells. d YAP/TAZ localization was quantitated & plotted as the mean ± SD (n = 3) with representative images shown on the right. Scale bars, 25 μm. N: nuclear, C: cytoplasmic. e Target gene expression was determined by qPCR. Data are plotted as the mean ± SD (n = 3). f YAP/TAZ phosphorylation was monitored using Phos-Tag gels. Relative phosphorylation levels from blots is quantitated (right) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30158528), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for NUAK2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50-1:200
Western Blot
0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: NUAK2
Long Name
NUAK family SNF1-like kinase 2
Alternate Names
OMPHK2, SNARK
Entrez Gene IDs
81788 (Human)
Gene Symbol
NUAK2
UniProt
Additional NUAK2 Products
Product Documents for NUAK2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for NUAK2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for NUAK2 Antibody - BSA Free
Customer Reviews for NUAK2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review NUAK2 Antibody - BSA Free and earn rewards!
Have you used NUAK2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...