NUDC Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89517

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWT

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NUDC Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NUDC Antibody [NBP1-89517]

Immunocytochemistry/ Immunofluorescence: NUDC Antibody [NBP1-89517]

Immunocytochemistry/Immunofluorescence: NUDC Antibody [NBP1-89517] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517]

Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517]

Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517]

Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517]

Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human cerebral cortex, fallopian tube, prostate and testis using Anti-NUDC antibody NBP1-89517 (A) shows similar protein distribution across tissues to independent antibody NBP1-89510 (B).
Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517]

Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517]

Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human cerebral cortex shows weak to moderate cytoplasmic and nuclear positivity in neurons.
Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517]

Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517]

Immunohistochemistry-Paraffin: NUDC Antibody [NBP1-89517] - Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.
NUDC Antibody - BSA Free Immunohistochemistry-Paraffin: NUDC Antibody - BSA Free [NBP1-89517]

Immunohistochemistry-Paraffin: NUDC Antibody - BSA Free [NBP1-89517]

Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.
Western Blot: NUDC Antibody [NBP1-89517]

Western Blot: NUDC Antibody [NBP1-89517]

Western Blot: NUDC Antibody [NBP1-89517] - Analysis using Anti-NUDC antibody NBP1-89517 (A) shows similar pattern to independent antibody NBP1-89510 (B).
NUDC Antibody - BSA Free Western Blot: NUDC Antibody - BSA Free [NBP1-89517]

Western Blot: NUDC Antibody - BSA Free [NBP1-89517]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Applications for NUDC Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NUDC

NudC was first identified as a regulator of nuclear movement in the asexual reproductive cycle of the filamentous fungus Aspergillus nidulans. Human NUDC is a nuclear movement protein that associates with dynein (see DYNC1H1; MIM 600112) (Aumais et al., 2003 [PubMed 12679384]).[supplied by OMIM]

Alternate Names

HNUDC, MNUDC, NPD011, nuclear distribution gene C (A.nidulans) homolog, nuclear distribution gene C homolog (A. nidulans), Nuclear distribution protein C homolog, nuclear migration protein nudC, NudC

Gene Symbol

NUDC

Additional NUDC Products

Product Documents for NUDC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NUDC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NUDC Antibody - BSA Free

Customer Reviews for NUDC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NUDC Antibody - BSA Free and earn rewards!

Have you used NUDC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...