OCIAD2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82683

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GVCQSKFHFFEDQLRGAGFGPQHNRHCLLTCEECKIKHGLSEKGDSQPSAS

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for OCIAD2 Antibody - BSA Free

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683]

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683]

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Staining in human kidney and skeletal muscle tissues using anti-OCIAD2 antibody. Corresponding OCIAD2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683]

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683]

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Staining of human kidney, liver, skeletal muscle and stomach using Anti-OCIAD2 antibody NBP1-82683 (A) shows similar protein distribution across tissues to independent antibody NBP1-82682 (B).
Western Blot: OCIAD2 Antibody [NBP1-82683]

Western Blot: OCIAD2 Antibody [NBP1-82683]

Western Blot: OCIAD2 Antibody [NBP1-82683] - Analysis in human cell lines U-251MG and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: OCIAD2 Antibody [NBP1-82683]

Immunocytochemistry/ Immunofluorescence: OCIAD2 Antibody [NBP1-82683]

Immunocytochemistry/Immunofluorescence: OCIAD2 Antibody [NBP1-82683] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683]

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683]

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683]

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683]

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683]

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683]

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Staining of human liver.
Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683]

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683]

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Staining of human stomach.
Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683]

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683]

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Staining of human kidney using Anti-OCIAD2 antibody NBP1-82683.
Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683]

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683]

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Staining of human skeletal muscle using Anti-OCIAD2 antibody NBP1-82683.

Applications for OCIAD2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 -1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OCIAD2

Alternate Names

MGC45416, OCIA domain containing 2, OCIA domain-containing protein 2, ovarian carcinoma immunoreactive antigen, ovarian carcinoma immunoreactive antigen-like protein

Gene Symbol

OCIAD2

Additional OCIAD2 Products

Product Documents for OCIAD2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OCIAD2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OCIAD2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OCIAD2 Antibody - BSA Free and earn rewards!

Have you used OCIAD2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...