OIP5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13688

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all OIP5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: CGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVT

Reactivity Notes

Rat (80%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for OIP5 Antibody - BSA Free

Western Blot: OIP5 Antibody [NBP2-13688]

Western Blot: OIP5 Antibody [NBP2-13688]

Western Blot: OIP5 Antibody [NBP2-13688] - Analysis in human cell line K562.
Immunocytochemistry/ Immunofluorescence: OIP5 Antibody [NBP2-13688]

Immunocytochemistry/ Immunofluorescence: OIP5 Antibody [NBP2-13688]

Immunocytochemistry/Immunofluorescence: OIP5 Antibody [NBP2-13688] - Staining of human cell line PC-3 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688]

Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688]

Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688] - Staining of human tonsil shows no positivity in germinal center cells as expected.
Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688]

Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688]

Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688] - Analysis in human testis and prostate tissues. Corresponding OIP5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688]

Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688]

Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688]

Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688]

Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688] - Staining of human prostate shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688]

Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688]

Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688] - Staining of human testis shows strong positivity in acrosomes.

Applications for OIP5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OIP5

Commonly referred to as OIP5, Opa interacting protein 5 is essential to protein binding. More specifically, OIP5 is necessary for the recruitment of CENPA to centromeres and normal chromosome segregation during mitosis. OIP5 interacts with other proteins such as RAF1, BRAF, CENPA, CENPN, and HJURP and also binds UBC, TMPO, MIS18A, CASP10 and RARG.

Alternate Names

Cancer/testis antigen 86, CT865730547N13Rik, hMIS18beta, LAP2alpha interactor-25, LINT-25, MIS18B, MIS18beta, OIP-5, Opa interacting protein 5, Opa-interacting protein 5, protein Mis18-beta

Gene Symbol

OIP5

Additional OIP5 Products

Product Documents for OIP5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for OIP5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OIP5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OIP5 Antibody - BSA Free and earn rewards!

Have you used OIP5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies