Oncostatin M/OSM Antibody (8O8K9)

Novus Biologicals | Catalog # NBP3-16686

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8O8K9 expressed in HEK293
View all Oncostatin M/OSM Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Oncostatin M/OSM (P13725). MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLN

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Oncostatin M/OSM Antibody (8O8K9)

Western Blot: Oncostatin M/OSM Antibody (8O8K9) [NBP3-16686]

Western Blot: Oncostatin M/OSM Antibody (8O8K9) [NBP3-16686]

Western Blot: Oncostatin M/OSM Antibody (8O8K9) [NBP3-16686] - Western blot analysis of extracts of various cell lines, using Oncostatin M/OSM Rabbit mAb (NBP3-16686) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Oncostatin M/OSM Antibody (8O8K9) [NBP3-16686]

Immunocytochemistry/ Immunofluorescence: Oncostatin M/OSM Antibody (8O8K9) [NBP3-16686]

Immunocytochemistry/Immunofluorescence: Oncostatin M/OSM Antibody (8O8K9) [NBP3-16686] - Immunofluorescence analysis of Jurkat cells using Oncostatin M/OSM Rabbit mAb (NBP3-16686) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry: Oncostatin M/OSM Antibody (8O8K9) [NBP3-16686]

Immunohistochemistry: Oncostatin M/OSM Antibody (8O8K9) [NBP3-16686]

Immunohistochemistry: Oncostatin M/OSM Antibody (8O8K9) [NBP3-16686] - Immunofluorescence analysis of mouse spleen using Oncostatin M/OSM Rabbit mAb (NBP3-16686) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Oncostatin M/OSM Antibody (8O8K9)

Immunocytochemistry/ Immunofluorescence: Oncostatin M/OSM Antibody (8O8K9) [NBP3-16686] -

Immunocytochemistry/ Immunofluorescence: Oncostatin M/OSM Antibody (8O8K9) [NBP3-16686] - Immunofluorescence analysis of paraffin-embedded rat spleen using Oncostatin M/OSM Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Oncostatin M/OSM Antibody (8O8K9)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:100 - 1:400

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Oncostatin M/OSM

Oncostatin M is a 252 amino acid protein that is 28 kDa, acts as growth regulator inhibiting the proliferation of a number of tumor cell lines and stimulating the proliferation of AIDS-KS cells; regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells; uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST), and is involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration. This protein is being studied for its involvement in several diseases and disorders including arterial occlusive disease, peripheral arterial occlusive disease, leukemia, kaposi's sarcoma, abdominal aortic aneurysm, status epilepticus, primary cutaneous amyloidosis, aortic aneurysm, bullous pemphigoid, neonatal jaundice, cutaneous malignant melanoma, plasmacytoma, systemic mastocytosis, mastocytosis, cervical squamous cell carcinoma, systemic lupus erythematosus, allergic rhinitis, squamous cell carcinoma, and lupus erythematosus. The protein has been linked to immune response IL-3 activation and signaling pathway, immune response oncostatin M signaling via JAK-Stat in human cells, development thrombopoetin signaling via JAK-STAT pathway, immune response Oncostatin M signaling via MAPK in human cells, MAPK signaling, endothelin-1 signaling pathway, molecular mechanisms of cancer, antioxidant action of vitamin-C, and Rho Family GTPases pathways where it interacts with IL6ST, TNNT1, LIFR, COL4A4, and COL4A6.

Alternate Names

MGC20461, oncostatin M, oncostatin-M

Gene Symbol

OSM

Additional Oncostatin M/OSM Products

Product Documents for Oncostatin M/OSM Antibody (8O8K9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Oncostatin M/OSM Antibody (8O8K9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Oncostatin M/OSM Antibody (8O8K9)

There are currently no reviews for this product. Be the first to review Oncostatin M/OSM Antibody (8O8K9) and earn rewards!

Have you used Oncostatin M/OSM Antibody (8O8K9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies