Osteopontin/OPN Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59190

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SPP1 (secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1)) The peptide sequence was selected from the C terminal of SPP1 (NP_000573). Peptide sequence DSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Osteopontin/OPN Antibody - BSA Free

Western Blot: Osteopontin/OPN Antibody [NBP1-59190]

Western Blot: Osteopontin/OPN Antibody [NBP1-59190]

Western Blot: Osteopontin/OPN Antibody [NBP1-59190] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: Osteopontin/OPN Antibody [NBP1-59190]

Immunohistochemistry-Paraffin: Osteopontin/OPN Antibody [NBP1-59190]

Immunohistochemistry-Paraffin: Osteopontin/OPN Antibody [NBP1-59190] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: Osteopontin/OPN Antibody [NBP1-59190]

Western Blot: Osteopontin/OPN Antibody [NBP1-59190]

Western Blot: Osteopontin/OPN Antibody [NBP1-59190] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%
Osteopontin/OPN Antibody - BSA Free

Western Blot: Osteopontin/OPN Antibody - BSA Free [NBP1-59190] -

Western blot analysis of principal marker of bone homing. (A) Western blot analysis of Versican, Osteopontin, and Prolactin receptor in MCF-7 cells untreated and treated with IL-1 beta and AZA after 48 h. Representative images of WB and densitometric analysis (Mean +/- SD) of Versican, Osteopontin, and Prolactin receptor. One-way ANOVA showed significant effect of treatment on densitometric data (p < 0.0005); significant differences were highlighted among tested treatments (p < 0.0005), except for Prolactin receptor with AZA (NS). (B) Western blot analysis of Versican, Osteopontin, and Prolactin receptor in MCF-7 cells untreated and treated with IL-1 beta and Bobcat339 (33 uM and 75 uM) and relative co-treatments after 48 h. Representative images of WB and densitometric analysis (Mean +/- SD, n = 3) of Versican, Osteopontin, and Prolactin receptor. One-way ANOVA showed significant effect of treatment on densitometric data; significant differences among tested treatments versus untreated MCF-7 (*), and among IL-1 beta /BC co-treatments versus the IL-1 beta one () are reported in the graphs (*** and, p < 0.0005). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36499741), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Osteopontin/OPN Antibody - BSA Free

Western Blot: Osteopontin/OPN Antibody - BSA Free [NBP1-59190] -

Western blot analysis of principal marker of bone homing. (A) Western blot analysis of Versican, Osteopontin, and Prolactin receptor in MCF-7 cells untreated and treated with IL-1 beta and AZA after 48 h. Representative images of WB and densitometric analysis (Mean +/- SD) of Versican, Osteopontin, and Prolactin receptor. One-way ANOVA showed significant effect of treatment on densitometric data (p < 0.0005); significant differences were highlighted among tested treatments (p < 0.0005), except for Prolactin receptor with AZA (NS). (B) Western blot analysis of Versican, Osteopontin, and Prolactin receptor in MCF-7 cells untreated and treated with IL-1 beta and Bobcat339 (33 uM and 75 uM) and relative co-treatments after 48 h. Representative images of WB and densitometric analysis (Mean +/- SD, n = 3) of Versican, Osteopontin, and Prolactin receptor. One-way ANOVA showed significant effect of treatment on densitometric data; significant differences among tested treatments versus untreated MCF-7 (*), and among IL-1 beta /BC co-treatments versus the IL-1 beta one () are reported in the graphs (*** and, p < 0.0005). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36499741), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Osteopontin/OPN Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml
Application Notes
Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 26770207).

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Osteopontin/OPN

The SPP1 gene encodes an acidic matrix protein, mainly expressed in mineralized tissues, kidney and atherosclerotic vessels. This protein also contributes to several steps in the process of prostate carcinogenesis and metastasis.

Long Name

Secreted Phosphoprotein 1 [BNSP]

Alternate Names

Eta-1, OPN, Spp1

Entrez Gene IDs

6696 (Human)

Gene Symbol

SPP1

Additional Osteopontin/OPN Products

Product Documents for Osteopontin/OPN Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Osteopontin/OPN Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Osteopontin/OPN Antibody - BSA Free

Customer Reviews for Osteopontin/OPN Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Osteopontin/OPN Antibody - BSA Free and earn rewards!

Have you used Osteopontin/OPN Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Osteopontin/OPN Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I ordered this antibody and used it to detect osteopontin isolated from bovine milk. Three bands were detected when this antibody was used and one intense band showed similar molecular weight with casein. Since casein is abundant in milk, I am wondering if this osteopontin antibody has been tested to cross react with other proteins?

    A: The immunogen for this antibody shows no similarity with casein, so is not predicted to cross-react. It hasn't been directly tested for this, but no other proteins show up in a BLAST of the immunogen, so most likely this is something that is uncharacterized.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies