OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88095

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PHQDSIPSLEPGSHSKDGLHRGALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat 87%, Mouse 86%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095]

Immunocytochemistry/ Immunofluorescence: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095]

OTUD7B-Cezanne-ZA20D1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88095-img0011.jpg
OTUD7B/Cezanne/ZA20D1 Antibody

Western Blot: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] -

Western Blot: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] - COP1 & OTUD7B coordinate to control NPCs differentiation. a, b NPCs were plated in Matrigel-coated six-well plate for neuronal differentiation. For the indicated times, immunoblotting (a) & immunofluorescence (b) of Sox2, CUL4A, COP1, OTUD7B & TUJ1 were performed. c Cells transfected with HA-Ub & indicated shRNA were treated by MG132 for 8 h, & the lysates were immunoprecipated with anti-Sox2 antibody & immunoblotted with anti-HA. d Summary of our findings. OTUD7B stabilizes Sox2 through deubiquitylation & maintains the stemness of NPCs, while CUL4ADET1-COP1 promotes Sox2 degradation through ubiquitylation & induces differentiation of NPCs. OTUD7B & CUL4ADET1-COP1 exert opposite roles in regulating Sox2 protein stability at the post-translational level. The representative images are shown from three independent experiments. Unprocessed original scans of blots are shown in Supplementary Fig. 9 Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30405104), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Immunohistochemistry-Paraffin: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095]

Immunohistochemistry-Paraffin: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095]

Immunohistochemistry-Paraffin: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.
OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free Western Blot: OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free [NBP1-88095]

Western Blot: OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free [NBP1-88095]

Analysis in human cell line SiHa.
OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free [NBP1-88095]

Immunocytochemistry/ Immunofluorescence: OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free [NBP1-88095]

Staining of human cell line U-251 MG shows localization to nucleoplasm & microtubules.

Applications for OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OTUD7B/Cezanne

ZA20D1 has deubiquitinating activity that is directed towards 'Lys-48' or 'Lys-63'-linked polyubiquitin chains.Hydrolyzes both linear and branched forms of polyubiquitin. Negative regulator of nuclear factor NF-kappa-B

Long Name

OTU Domain-containing Protein 7B

Alternate Names

Cezanne, ZA20D1

Gene Symbol

OTUD7B

Additional OTUD7B/Cezanne Products

Product Documents for OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free

Customer Reviews for OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free and earn rewards!

Have you used OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Ubiquitination Cascade Pathway
Ubiquitination Cascade Pathway Thumbnail