OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-88095
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human, Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PHQDSIPSLEPGSHSKDGLHRGALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYG
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat 87%, Mouse 86%
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free [NBP1-88095]
Staining of human cell line U-251 MG shows localization to nucleoplasm & microtubules.Immunocytochemistry/ Immunofluorescence: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095]
OTUD7B-Cezanne-ZA20D1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88095-img0011.jpgWestern Blot: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] -
Western Blot: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] - COP1 & OTUD7B coordinate to control NPCs differentiation. a, b NPCs were plated in Matrigel-coated six-well plate for neuronal differentiation. For the indicated times, immunoblotting (a) & immunofluorescence (b) of Sox2, CUL4A, COP1, OTUD7B & TUJ1 were performed. c Cells transfected with HA-Ub & indicated shRNA were treated by MG132 for 8 h, & the lysates were immunoprecipated with anti-Sox2 antibody & immunoblotted with anti-HA. d Summary of our findings. OTUD7B stabilizes Sox2 through deubiquitylation & maintains the stemness of NPCs, while CUL4ADET1-COP1 promotes Sox2 degradation through ubiquitylation & induces differentiation of NPCs. OTUD7B & CUL4ADET1-COP1 exert opposite roles in regulating Sox2 protein stability at the post-translational level. The representative images are shown from three independent experiments. Unprocessed original scans of blots are shown in Supplementary Fig. 9 Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30405104), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry-Paraffin: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095]
Immunohistochemistry-Paraffin: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.Western Blot: OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free [NBP1-88095]
Analysis in human cell line SiHa.Applications for OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: OTUD7B/Cezanne
Long Name
OTU Domain-containing Protein 7B
Alternate Names
Cezanne, ZA20D1
Gene Symbol
OTUD7B
Additional OTUD7B/Cezanne Products
Product Documents for OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free
Customer Reviews for OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free and earn rewards!
Have you used OTUD7B/Cezanne/ZA20D1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...