p16INK4a/CDKN2A Antibody (0D0C8)
Novus Biologicals | Catalog # NBP3-15420
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human
Applications
Knockout Validated, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 0D0C8 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 57-156 of human p16INK4a/CDKN2A (P42771). ARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for p16INK4a/CDKN2A Antibody (0D0C8)
Immunocytochemistry/ Immunofluorescence: p16INK4a/CDKN2A Antibody (0D0C8) [p16INK4a/CDKN2A] -
Immunocytochemistry/ Immunofluorescence: p16INK4a/CDKN2A Antibody (0D0C8) [p16INK4a/CDKN2A] - Confocal imaging of HeLa cells using [KO Validated] p16INK4a/CDKN2A Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.p16INK4a/CDKN2A Antibody (0D0C8) [p16INK4a/CDKN2A] -
Analysis of lysates from wild type (WT) and CDKN2A/p16INK4a knockout (KO) 293T cells using [KO Validated] CDKN2A/p16INK4a Rabbit mAb at 1:5000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 20s.p16INK4a/CDKN2A Antibody (0D0C8) [p16INK4a/CDKN2A] -
Analysis of various lysates using [KO Validated] CDKN2A/p16INK4a Rabbit mAb at 1:5000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 20s.Applications for p16INK4a/CDKN2A Antibody (0D0C8)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL.
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:1000 - 1:5000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: p16INK4a / CDKN2A
Long Name
p16 Cyclin Dependent Kinase 4 Inhibitor 2A
Alternate Names
ARF, CDK4I, CDKN2A, INK4a, MLM, p14ARF, p16, p19ARF
Gene Symbol
CDKN2A
Additional p16INK4a / CDKN2A Products
Product Documents for p16INK4a/CDKN2A Antibody (0D0C8)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for p16INK4a/CDKN2A Antibody (0D0C8)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for p16INK4a/CDKN2A Antibody (0D0C8)
There are currently no reviews for this product. Be the first to review p16INK4a/CDKN2A Antibody (0D0C8) and earn rewards!
Have you used p16INK4a/CDKN2A Antibody (0D0C8)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...