p66 beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87358

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all p66 beta Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: NLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLTPSPDIIVLSDNEASSPRSSSRMEERLKAANLEMFKGKGIEERQQLIKQLRDELRLEEARLV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for p66 beta Antibody - BSA Free

Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358]

Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358]

Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358] - Analysis in human cerebral cortex and liver tissues using NBP1-87358 antibody. Corresponding GATAD2B RNA-seq data are presented for the same tissues.
Western Blot: p66 beta Antibody [NBP1-87358]

Western Blot: p66 beta Antibody [NBP1-87358]

Western Blot: p66 beta Antibody [NBP1-87358] - Analysis in SK-BR-3 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GATAD2B antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: p66 beta Antibody [NBP1-87358]

Immunocytochemistry/ Immunofluorescence: p66 beta Antibody [NBP1-87358]

Immunocytochemistry/Immunofluorescence: p66 beta Antibody [NBP1-87358] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358]

Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358]

Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358] - Staining of human Liver shows very weak nuclear positivity in hepatocytes.
Western Blot: p66 beta Antibody [NBP1-87358]

Western Blot: p66 beta Antibody [NBP1-87358]

Western Blot: p66 beta Antibody [NBP1-87358] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358]

Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358]

Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358] - Staining of human Cerebellum shows strong nuclear positivity in Purkinje cells.
Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358]

Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358]

Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358] - Staining of human Cerebral cortex shows strong nuclear positivity in neuronal and glial cells.
Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358]

Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358]

Immunohistochemistry-Paraffin: p66 beta Antibody [NBP1-87358] - Staining of human Lymph node shows strong nuclear positivity in germinal and non-germinal center cells.
p66 beta Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: p66 beta Antibody - BSA Free [NBP1-87358]

Chromatin Immunoprecipitation-exo-Seq: p66 beta Antibody - BSA Free [NBP1-87358]

ChIP-Exo-Seq composite graph for Anti-GATAD2B (NBP1-87358) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for p66 beta Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: p66 beta

P66beta/GATAD2B interacts with MBD2 (methyl-CpG-binding domain 2) and MBD3 (methyl-CpG-binding domain 3) and participates in transcriptional repression in association with the MBD2/NuRD and MBD3/NuRD histone deacetylase complexes. P66beta/GATAD2B is SUMOylated in vivo and its repressive activity has been shown to be enhanced by SUMOylation. Alternate names for P66beta/GATAD2B include transcriptional repressor p66 beta, p66/p68, GATA zinc-finger domain-containing protein 2B, FLJ37346, and KIAA1150.

Alternate Names

FLJ37346, GATA zinc finger domain containing 2B, GATA zinc finger domain-containing protein 2B, KIAA1150, MGC138257, MGC138285, p66/p68, P66beta, RP11-216N14.6, transcription repressor p66 beta component of the MeCP1 complex, transcriptional repressor p66-beta

Entrez Gene IDs

57459 (Human)

Gene Symbol

GATAD2B

UniProt

Q8WXI9 (Human)

Additional p66 beta Products

Product Documents for p66 beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for p66 beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for p66 beta Antibody - BSA Free

Customer Reviews for p66 beta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review p66 beta Antibody - BSA Free and earn rewards!

Have you used p66 beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies