PAC1R Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38030

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 25-140 of human PAC1R (NP_001109.2).

Sequence:
CIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PAC1R Antibody - BSA Free

PAC1R Antibody

Immunocytochemistry/ Immunofluorescence: PAC1R Antibody [NBP3-38030] -

Immunocytochemistry/ Immunofluorescence: PAC1R Antibody [NBP3-38030] - Immunofluorescence analysis of SH-SY5Y cells using PAC1R Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
PAC1R Antibody

Western Blot: PAC1R Antibody [NBP3-38030] -

Western Blot: PAC1R Antibody [NBP3-38030] - Western blot analysis of lysates from Mouse heart, using PAC1R Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.
PAC1R Antibody

Western Blot: PAC1R Antibody [NBP3-38030] -

Western Blot: PAC1R Antibody [NBP3-38030] - Western blot analysis of lysates from U-87MG cells, using PAC1R Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
PAC1R Antibody

Immunocytochemistry/ Immunofluorescence: PAC1R Antibody [NBP3-38030] -

Immunocytochemistry/ Immunofluorescence: PAC1R Antibody [NBP3-38030] - Immunofluorescence analysis of NIH/3T3 cells using PAC1R Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
PAC1R Antibody

Immunocytochemistry/ Immunofluorescence: PAC1R Antibody [NBP3-38030] -

Immunocytochemistry/ Immunofluorescence: PAC1R Antibody [NBP3-38030] - Immunofluorescence analysis of C6 cells using PAC1R Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for PAC1R Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PAC1R

The pituitary adenylate cyclase-activating peptide receptor (PAC1) is a member of a family of three G-protein coupled receptors which mediate VIP (vasoactive intestinal peptide) and PACAP (pituitary adenlyate cyclase activating peptide) function in a variety of tissues. PAC1 demonstrates a higher affinity for PACAP than VIP. Expression of the VIP and VACAP receptors has been linked to the presence of human tumors.

Long Name

Pituitary Adenylate Cyclase Activating Polypeptide 1 Receptor Type I

Alternate Names

ADCYAP1R1, PACAPR, PACAPRI

Gene Symbol

ADCYAP1R1

Additional PAC1R Products

Product Documents for PAC1R Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PAC1R Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PAC1R Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAC1R Antibody - BSA Free and earn rewards!

Have you used PAC1R Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...