PADI4 Antibody (4D8) - Azide and BSA Free
Novus Biologicals | Catalog # H00023569-M01
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse
Cited:
Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Cited:
Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2b Kappa Clone # 4D8
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
PADI4 (NP_004247, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHSPPAKKKSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYYGPKTPPVKALLYL
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 21415415).
Specificity
peptidyl arginine deiminase, type IV
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2b Kappa
Scientific Data Images for PADI4 Antibody (4D8) - Azide and BSA Free
Western Blot: PADI4 Antibody (4D8) [H00023569-M01]
Western Blot: PADI4 Antibody (4D8) [H00023569-M01] - detection against Immunogen (38.1 KDa).Immunocytochemistry/ Immunofluorescence: PADI4 Antibody (4D8) [H00023569-M01]
Immunocytochemistry/Immunofluorescence: PADI4 Antibody (4D8) [H00023569-M01] - Analysis of monoclonal antibody to PADI4 on HeLa cell. Antibody concentration 10 ug/ml.Western Blot: PADI4 Antibody (4D8) [H00023569-M01] -
Western Blot: PADI4 Antibody (4D8) [H00023569-M01] - Detection of enzymatically active peptidyl arginine deiminase (PAD) in the synovial fluid (SF) of patients with rheumatoid arthritis (RA). A, Immunoblotting of albumin‐depleted SF samples from 8 RA patients shows presence of neutrophil elastase (NE), PAD4, & PAD2. B, PAD activity in the SF of patients with RA (n = 12) was significantly higher than that in the SF of patients with osteoarthritis (OA) (n = 9). C, PAD activity was observed in the OA SF & RA SF both at physiologic calcium concentrations & at higher calcium concentrations (5 mM). In B & C, symbols represent individual patients; horizontal bars show the median. D, PAD activity is significantly correlated with DNA levels in the SF of RA patients (n = 22). Data were analyzed using Spearman's rho test for correlation. ∗ = P < 0.05; ∗∗ = P < 0.01, by Mann‐Whitney U test. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/26245941), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: PADI4 Antibody (4D8) [H00023569-M01] -
Western Blot: PADI4 Antibody (4D8) [H00023569-M01] - Release of peptidyl arginine deiminases (PADs) into the supernatant during NETosis, & detection of enzymatically active PADs. A, DNA release in peripheral blood neutrophils from healthy donors that were left unstimulated or stimulated with 25 mM phorbol myristate acetate (PMA) was assessed for up to 240 minutes after stimulation. Bars show the mean ± SD of 8 samples per group. B, For isolation of neutrophil extracellular traps, supernatants (SN) of unstimulated (unst.) or stimulated (stim.) neutrophils were collected. Subsequently, the cells were washed 3 times with RPMI medium (W1–W3), & stimulated cells were incubated in the absence or presence of DNase I; unstimulated cells treated with DNase I served as a control. Bars show the mean ± SD DNA concentration (conc) in 7 samples per group. C, Proteins (PAD2, PAD4, & neutrophil elastase [NE]) were precipitated from the same supernatants of unstimulated or stimulated cells as described in B & analyzed by Western blotting. Citrullinated proteins (citr.prot.) were detected using chemical modification & anti–modified citrulline antibody. PAD2 & PAD4 antibodies were tested for cross‐reactivity using human (hu) recombinant PAD4 (rPAD4) (250 ng) & human skeletal muscle tissue lysate (15 μg). One representative blot of 4 independent experiments is shown for each group. D, PAD activity in supernatants of unstimulated & stimulated cells was compared. Symbols represent individual donors (n = 10); bars show the median. ∗ = P < 0.05; ∗∗ = P < 0.01, by Wilcoxon's matched pairs signed rank test. AFU = arbitrary fluorescence units; NS = not significant. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/26245941), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for PADI4 Antibody (4D8) - Azide and BSA Free
Application
Recommended Usage
ELISA
1:100-1:2000
Immunocytochemistry/ Immunofluorescence
1:10-1:500
Immunohistochemistry
1:10-1:500
Immunohistochemistry-Paraffin
1:10-1:500
Western Blot
1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. Use in Immunohistochemistry-Paraffin reported in scientific literature (PMID 21415415)
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: PADI4
Long Name
Peptidyl Arginine Deiminase type IV
Alternate Names
HL-60 PAD, PAD, PAD4, PDI4
Entrez Gene IDs
23569 (Human)
Gene Symbol
PADI4
OMIM
180300 (Human)
UniProt
Additional PADI4 Products
Product Documents for PADI4 Antibody (4D8) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PADI4 Antibody (4D8) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for PADI4 Antibody (4D8) - Azide and BSA Free
Customer Reviews for PADI4 Antibody (4D8) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review PADI4 Antibody (4D8) - Azide and BSA Free and earn rewards!
Have you used PADI4 Antibody (4D8) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...