PANP/PILR alpha associated neural protein Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-90541
![PANP/PILR alpha associated neural protein Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: PANP/PILR alpha associated neural protein Antibody - BSA Free [NBP1-90541]](https://resources.rndsystems.com/images/products/nbp1-90541_rabbit-polyclonal-panp-pilr-alpha-associated-neural-protein-antibody-29520251617377.jpg "Immunocytochemistry/ Immunofluorescence: PANP/PILR alpha associated neural protein Antibody - BSA Free [NBP1-90541]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Predicted:
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DRSQKRRRPSGQQGALRQEESQQPLTDLSPAGVTVLGAFGDSPTPTPDHEEPRGGPRPGMPHPKGAPAFQLNR
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for PANP/PILR alpha associated neural protein Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: PANP/PILR alpha associated neural protein Antibody - BSA Free [NBP1-90541]
Staining of human cell line SH-SY5Y shows localization to nucleoplasm.![PANP/PILR alpha associated neural protein Antibody - BSA Free Immunohistochemistry: PANP/PILR alpha associated neural protein Antibody - BSA Free [NBP1-90541]](https://resources.rndsystems.com/images/products/nbp1-90541_rabbit-polyclonal-panp-pilr-alpha-associated-neural-protein-antibody-30520251052517.jpg "Immunohistochemistry: PANP/PILR alpha associated neural protein Antibody - BSA Free [NBP1-90541]")
![Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541]](https://resources.rndsystems.com/images/products/PANP-PILR-alpha-associated-neural-protein-Antibody-Immunohistochemistry-Paraffin-NBP1-90541-img0012.jpg "Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541]")
Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541]
Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.![Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541]](https://resources.rndsystems.com/images/products/PANP-PILR-alpha-associated-neural-protein-Antibody-Immunohistochemistry-Paraffin-NBP1-90541-img0013.jpg "Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541]")
Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541]
Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.![Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541]](https://resources.rndsystems.com/images/products/PANP-PILR-alpha-associated-neural-protein-Antibody-Immunohistochemistry-Paraffin-NBP1-90541-img0014.jpg "Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541]")
Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541]
Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.![Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541]](https://resources.rndsystems.com/images/products/PANP-PILR-alpha-associated-neural-protein-Antibody-Immunohistochemistry-Paraffin-NBP1-90541-img0011.jpg "Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541]")
Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541]
Immunohistochemistry-Paraffin: PANP/PILR alpha associated neural protein Antibody [NBP1-90541] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.![PANP/PILR alpha associated neural protein Antibody - BSA Free Western Blot: PANP/PILR alpha associated neural protein Antibody - BSA Free [NBP1-90541]](https://resources.rndsystems.com/images/products/nbp1-90541_rabbit-polyclonal-panp-pilr-alpha-associated-neural-protein-antibody-295202516253121.jpg "Western Blot: PANP/PILR alpha associated neural protein Antibody - BSA Free [NBP1-90541]")
Western Blot: PANP/PILR alpha associated neural protein Antibody - BSA Free [NBP1-90541]
Analysis in control (vector only transfected HEK293T lysate) and PIANP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).Applications for PANP/PILR alpha associated neural protein Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: PANP
Long Name
PILR alpha Associated Neural Protein
Alternate Names
C12orf53, PIANP
Gene Symbol
PIANP
Additional PANP Products
Product Documents for PANP/PILR alpha associated neural protein Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PANP/PILR alpha associated neural protein Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for PANP/PILR alpha associated neural protein Antibody - BSA Free
Powered by Bioz
Customer Reviews for PANP/PILR alpha associated neural protein Antibody - BSA Free
There are currently no reviews for this product. Be the first to review PANP/PILR alpha associated neural protein Antibody - BSA Free and earn rewards!
Have you used PANP/PILR alpha associated neural protein Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for PANP/PILR alpha associated neural protein Antibody - BSA Free
Showing
1
-
1 of
1 FAQ
Showing All
-
Q: I plan to use NBP1-90541 for IHC-frozen, do you have any additional information for this?
A:
The product of interest, NBP1-90541 (PANP/PILR alpha associated neural protein Antibody), has never been validated in IHC-Fr, only IHC-P. In our experiences, the antibodies which can be used in IHC-P can be applied to IHC-Fr in some cases, provided some optimization (e.g. changing dilutions, etc) is performed. The only real wet-bench tests by you can determine whether NBP1-90541 is suitable to IHC-Fr. If indeed you use NBP1-90541 in IHC-Fr, you will be automatically qualified for our Innovator's Reward Program. Since this antibody has never been tested in IHC-Fr, our specialists will not know whether it will work in the application or how to make it work (i.e. no special IHC-Fr protocol for NBP1-90541). However our general IHC-Fr may be useful: Protocol. Checking the troubleshooting guide may help too: Troubleshooting Guide.
Loading...