PARL Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80878

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PARL Antibody - BSA Free

Western Blot: PARL Antibody [NBP1-80878]

Western Blot: PARL Antibody [NBP1-80878]

Western Blot: PARL Antibody [NBP1-80878] - Analysis in human cell line CACO-2 and human cell line HeLa.
Immunocytochemistry/ Immunofluorescence: PARL Antibody [NBP1-80878]

Immunocytochemistry/ Immunofluorescence: PARL Antibody [NBP1-80878]

Immunocytochemistry/Immunofluorescence: PARL Antibody [NBP1-80878] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: PARL Antibody [NBP1-80878]

Immunohistochemistry-Paraffin: PARL Antibody [NBP1-80878]

Immunohistochemistry-Paraffin: PARL Antibody [NBP1-80878] - Staining of human gallbladder shows moderate cytoplasmic positivity in glandular cells.
PARL Antibody - BSA Free

Western Blot: PARL Antibody - BSA Free [NBP1-80878] -

Meth exposure causes mitophagy and necroptosis in primary neurons. (A) Volcano plots of differential gene expression analysis. (B) GO pathway enrichment of differential gene expression analysis. (C) KEGG pathway enrichment of differential gene expression analysis. (D) Gene set enrichment analysis (GSEA) of mitophagy‐related and mitochondrial fission‐related RNA‐seq data. (E) PARL, PGAM5, PINK1, Parkin, MLKL, RIP1, and RIP3 mRNA levels in neurons. (F) KEGG pathway enrichment of differential protein expression analysis (Top 10). (G) Volca no plot of differential protein expression analysis. (H) PARL, PGAM5, PINK1, Parkin, MLKL, RIP1, and RIP3 protein levels. (I) Statistical results of the relative protein levels of PARL, PGAM5, PINK1, Parkin, MLKL, RIP1, and RIP3. Data are shown as the mean +/- SEM. Student's t‐test was used to measure the significance between two groups. *p < 0.05, **p < 0.01, ***p < 0.001, and ****p < 0.0001 versus Con group. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40013375), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for PARL Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PARL

PARL encodes a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. This gene may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in this gene has been associated with increased risk for type 2 diabetes. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Long Name

Presenilins Associated Rhomboid-like Protein

Alternate Names

PSARL1, RHBDS1

Entrez Gene IDs

55486 (Human)

Gene Symbol

PARL

UniProt

Additional PARL Products

Product Documents for PARL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PARL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PARL Antibody - BSA Free

Customer Reviews for PARL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PARL Antibody - BSA Free and earn rewards!

Have you used PARL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...