PAXX Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-94172

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LSKVPGPEAAPRLRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:29511619).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PAXX Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PAXX Antibody [NBP1-94172]

Immunocytochemistry/ Immunofluorescence: PAXX Antibody [NBP1-94172]

Immunocytochemistry/Immunofluorescence: PAXX Antibody [NBP1-94172] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172]

Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172]

Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172]

Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172]

Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172]

Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172]

Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172] - Staining of human prostate shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172]

Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172]

Immunohistochemistry-Paraffin: PAXX Antibody [NBP1-94172] - Staining of human stomach shows strong nuclear positivity in glandular cells.
Knockout Validated: PAXX Antibody [NBP1-94172]

Western Blot: PAXX Antibody [NBP1-94172]

Western Blot: PAXX Antibody [NBP1-94172] - Generation of Paxx-/- mice. Western blot analyses using Novus anti-PAXX immunoglobulins revealed the lack of PAXX protein in Paxx-/- tail fibroblasts, spleen, thymus, liver, and lungs when compared to Paxx+/+ controls and reduction of PAXX protein in Paxx+/- cells.
Knockout Validated: PAXX Antibody [NBP1-94172]

Western Blot: PAXX Antibody [NBP1-94172]

PAXX-Antibody-Knockout-Validated-NBP1-94172-img0014.jpg
PAXX Antibody

Western Blot: PAXX Antibody [NBP1-94172] -

Western Blot: PAXX Antibody [NBP1-94172] - Generation of Paxx−/− mice. (A) Top. Schematic diagram of murine Paxx locus indicating the ATG & STOP sites, & the targeted loci in the promoter region for sgRNA#1 & in exon 2 for sgRNA#2. Bottom. Resulting Paxx−/− locus lacking part of the promoter region, transcription start site, & exon 1. (B) PCR‐based genotyping strategy reveals the Paxx wt allele (965 bp) & Paxx null allele (270 bp). The following samples are presented, from left to right: two Paxx+/+ & two Paxx−/−. (C,D) Western blot analyses using Novus anti‐PAXX immunoglobulins revealed the lack of PAXX protein in Paxx−/− tail fibroblasts, spleen, thymus, liver, & lungs when compared to Paxx+/+ controls & reduction of PAXX protein in Paxx+/− cells. (E) Western blot using Abcam anti‐PAXX immunoglobulins showed no PAXX protein in Paxx−/− & reduction of PAXX protein in Paxx+/− livers compared to Paxx+/+. (F) Analyses of 184 pups born from Paxx+/− parents revealed expected genetic distribution of Paxx+/+ (43), Paxx+/− (89), & Paxx−/− (52) mice, which is close to 1 : 2 : 1 distribution. (G) Body weight of 30‐day‐old Paxx+/+ mice (n = 43) is not distinguishable from Paxx+/− (n = 60, P = 0.9559) & Paxx−/− mice (n = 99, P = 0.9629). Six Ku80−/− mice of the same age were significantly smaller than Paxx+/+, Paxx+/−, & Paxx−/− mice, P < 0.0001. (H) Example of 5‐week‐old mice, Paxx+/+, two Paxx+/−, & Paxx−/−, as indicated. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/29511619), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
PAXX Antibody

Western Blot: PAXX Antibody [NBP1-94172] -

Western Blot: PAXX Antibody [NBP1-94172] - Generation of Paxx−/− mice. (A) Top. Schematic diagram of murine Paxx locus indicating the ATG & STOP sites, & the targeted loci in the promoter region for sgRNA#1 & in exon 2 for sgRNA#2. Bottom. Resulting Paxx−/− locus lacking part of the promoter region, transcription start site, & exon 1. (B) PCR‐based genotyping strategy reveals the Paxx wt allele (965 bp) & Paxx null allele (270 bp). The following samples are presented, from left to right: two Paxx+/+ & two Paxx−/−. (C,D) Western blot analyses using Novus anti‐PAXX immunoglobulins revealed the lack of PAXX protein in Paxx−/− tail fibroblasts, spleen, thymus, liver, & lungs when compared to Paxx+/+ controls & reduction of PAXX protein in Paxx+/− cells. (E) Western blot using Abcam anti‐PAXX immunoglobulins showed no PAXX protein in Paxx−/− & reduction of PAXX protein in Paxx+/− livers compared to Paxx+/+. (F) Analyses of 184 pups born from Paxx+/− parents revealed expected genetic distribution of Paxx+/+ (43), Paxx+/− (89), & Paxx−/− (52) mice, which is close to 1 : 2 : 1 distribution. (G) Body weight of 30‐day‐old Paxx+/+ mice (n = 43) is not distinguishable from Paxx+/− (n = 60, P = 0.9559) & Paxx−/− mice (n = 99, P = 0.9629). Six Ku80−/− mice of the same age were significantly smaller than Paxx+/+, Paxx+/−, & Paxx−/− mice, P < 0.0001. (H) Example of 5‐week‐old mice, Paxx+/+, two Paxx+/−, & Paxx−/−, as indicated. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/29511619), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
PAXX Antibody - BSA Free Immunohistochemistry: PAXX Antibody - BSA Free [NBP1-94172]

Immunohistochemistry: PAXX Antibody - BSA Free [NBP1-94172]

Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
PAXX Antibody - BSA Free Western Blot: PAXX Antibody - BSA Free [NBP1-94172]

Western Blot: PAXX Antibody - BSA Free [NBP1-94172]

Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Applications for PAXX Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAXX

Alternate Names

chromosome 9 open reading frame 142, hypothetical protein LOC286257

Gene Symbol

PAXX

Additional PAXX Products

Product Documents for PAXX Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PAXX Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PAXX Antibody - BSA Free

Customer Reviews for PAXX Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAXX Antibody - BSA Free and earn rewards!

Have you used PAXX Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...