PBX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-31853

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSW

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PBX2 Antibody - BSA Free

Western Blot: PBX2 Antibody [NBP2-31853]

Western Blot: PBX2 Antibody [NBP2-31853]

Western Blot: PBX2 Antibody [NBP2-31853] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: PBX2 Antibody [NBP2-31853]

Immunocytochemistry/ Immunofluorescence: PBX2 Antibody [NBP2-31853]

Immunocytochemistry/Immunofluorescence: PBX2 Antibody [NBP2-31853] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]

Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]

Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]

Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]

Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human nasopharynx shows strong nuclear positivity in respiratory epithelial cells.
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]

Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]

Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]

Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]

Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]

Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]

Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Analysis in human epididymis and liver tissues using NBP2-31853 antibody. Corresponding PBX2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]

Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]

Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human epididymis shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]

Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]

Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]

Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]

Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human cervix shows moderate nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]

Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]

Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human liver shows no positivity in hepatocytes as expected.
PBX2 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: PBX2 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: PBX2 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-PBX2 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for PBX2 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PBX2

PBX2 encodes a ubiquitously expressed member of the TALE/PBX homeobox family. It was identified by its similarity to a homeobox gene which is involved in t(1;19) translocation in acute pre-B-cell leukemias. This protein is a transcriptional activator which binds to the TLX1 promoter. The gene is located within the major histocompatibility complex (MHC) on chromosome 6.

Alternate Names

G17Homeobox protein PBX2, HOX12homeobox 12, PBX2MHC, pre-B-cell leukemia homeobox 2, pre-B-cell leukemia transcription factor 2, Protein G17

Gene Symbol

PBX2

UniProt

Additional PBX2 Products

Product Documents for PBX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PBX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PBX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PBX2 Antibody - BSA Free and earn rewards!

Have you used PBX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...