![Western Blot: PBX2 Antibody [NBP2-31853]](https://resources.rndsystems.com/images/products/PBX2-Antibody-Western-Blot-NBP2-31853-img0004.jpg "Western Blot: PBX2 Antibody [NBP2-31853]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSW
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for PBX2 Antibody - BSA Free
Western Blot: PBX2 Antibody [NBP2-31853]
Western Blot: PBX2 Antibody [NBP2-31853] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp![Immunocytochemistry/ Immunofluorescence: PBX2 Antibody [NBP2-31853]](https://resources.rndsystems.com/images/products/PBX2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31853-img0006.jpg "Immunocytochemistry/ Immunofluorescence: PBX2 Antibody [NBP2-31853]")
Immunocytochemistry/ Immunofluorescence: PBX2 Antibody [NBP2-31853]
Immunocytochemistry/Immunofluorescence: PBX2 Antibody [NBP2-31853] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]](https://resources.rndsystems.com/images/products/PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0015.jpg "Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]")
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]](https://resources.rndsystems.com/images/products/PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0007.jpg "Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]")
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human nasopharynx shows strong nuclear positivity in respiratory epithelial cells.![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]](https://resources.rndsystems.com/images/products/PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0008.jpg "Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]")
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human epididymis shows high expression.![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]](https://resources.rndsystems.com/images/products/PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0009.jpg "Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]")
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human liver shows low expression as expected.![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]](https://resources.rndsystems.com/images/products/PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0011.jpg "Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]")
![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]](https://resources.rndsystems.com/images/products/PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0012.jpg "Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]")
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human epididymis shows moderate nuclear positivity in glandular cells.![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]](https://resources.rndsystems.com/images/products/PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0013.jpg "Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]")
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]](https://resources.rndsystems.com/images/products/PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0014.jpg "Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]")
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human cervix shows moderate nuclear positivity in squamous epithelial cells.![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]](https://resources.rndsystems.com/images/products/PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0016.jpg "Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]")
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853]
Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human liver shows no positivity in hepatocytes as expected.
Chromatin Immunoprecipitation ChIP: PBX2 Antibody - BSA Free
ChIP-Exo-Seq composite graph for Anti-PBX2 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.Applications for PBX2 Antibody - BSA Free
Application
Recommended Usage
Chromatin Immunoprecipitation-exo-Seq
1-10ug per reaction
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: PBX2
Alternate Names
G17Homeobox protein PBX2, HOX12homeobox 12, PBX2MHC, pre-B-cell leukemia homeobox 2, pre-B-cell leukemia transcription factor 2, Protein G17
Gene Symbol
PBX2
UniProt
Additional PBX2 Products
Product Documents for PBX2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for PBX2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for PBX2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review PBX2 Antibody - BSA Free and earn rewards!
Have you used PBX2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...