PDCD4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83302

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PDCD4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKE

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22747440)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit PDCD4 Antibody - BSA Free (NBP1-83302) is a polyclonal antibody validated for use in IHC and WB. Anti-PDCD4 Antibody: Cited in 7 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for PDCD4 Antibody - BSA Free

Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302]

Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302]

Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302] - Staining in human breast and skeletal muscle tissues. Corresponding PDCD4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302]

Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302]

Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302] - Staining of human thyroid gland shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302]

Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302]

Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302] - Staining of human breast shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302]

Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302]

Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302]

Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302]

Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302] - Staining of human skin shows strong nuclear positivity in epidermal cells.
Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302]

Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302]

Immunohistochemistry-Paraffin: PDCD4 Antibody [NBP1-83302] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
PDCD4 Antibody - BSA Free Western Blot: PDCD4 Antibody - BSA Free [NBP1-83302]

Western Blot: PDCD4 Antibody - BSA Free [NBP1-83302]

Analysis in human cell line Daudi.
PDCD4 Antibody - BSA Free Western Blot: PDCD4 Antibody - BSA Free [NBP1-83302]

Western Blot: PDCD4 Antibody - BSA Free [NBP1-83302]

Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
PDCD4 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: PDCD4 Antibody - BSA Free [NBP1-83302]

Chromatin Immunoprecipitation-exo-Seq: PDCD4 Antibody - BSA Free [NBP1-83302]

ChIP-Exo-Seq composite graph for Anti-PDCD4 (NBP1-83302) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for PDCD4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PDCD4

Programmed cell death 4 (Pdcd4) is a novel tumor suppressor. Pdcd4 directly inhibits the helicase activity of eukaryotic translation initiation factor 4A (eIF4A), a component of the translation initiation complex. Pdcd4 also suppresses the transactivation of activator protein-1 (AP-1)-responsive promoters by c-Jun. Pdcd4 contains two Akt phosphorylation sites, one at Ser67 and the other at Ser457. The phosphorylation of Pdcd4 by Akt causes nuclear translocation of Pdcd4 and a significant decrease in the ability of Pdcd4 to interfere with the transactivation of AP-1 responsive promoters by c-Jun.

Long Name

Programmed Cell Death 4

Alternate Names

H731, Protein 197/15a

Gene Symbol

PDCD4

Additional PDCD4 Products

Product Documents for PDCD4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PDCD4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers
Translation Regulation

Citations for PDCD4 Antibody - BSA Free

Customer Reviews for PDCD4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PDCD4 Antibody - BSA Free and earn rewards!

Have you used PDCD4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies