PDLIM7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84841

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (92%), Rat (92%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: HLTGTEFMQDPDEEHLKKSSQVPRTEAPAPASSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PDLIM7 Antibody - BSA Free

Western Blot: PDLIM7 Antibody [NBP1-84841]

Western Blot: PDLIM7 Antibody [NBP1-84841]

Western Blot: PDLIM7 Antibody [NBP1-84841] - Analysis using Anti-PDLIM7 antibody NBP1-84841 (A) shows similar pattern to independent antibody NBP2-58734 (B).
Immunocytochemistry/ Immunofluorescence: PDLIM7 Antibody [NBP1-84841]

Immunocytochemistry/ Immunofluorescence: PDLIM7 Antibody [NBP1-84841]

Immunocytochemistry/Immunofluorescence: PDLIM7 Antibody [NBP1-84841] - Staining of human cell line U-251 MG shows localization to actin filaments and focal adhesion sites. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PDLIM7 Antibody [NBP1-84841]

Immunohistochemistry-Paraffin: PDLIM7 Antibody [NBP1-84841]

Immunohistochemistry-Paraffin: PDLIM7 Antibody [NBP1-84841] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Western Blot: PDLIM7 Antibody [NBP1-84841]

Western Blot: PDLIM7 Antibody [NBP1-84841]

PDLIM7-Antibody-Western-Blot-NBP1-84841-img0012.jpg
PDLIM7 Antibody - BSA Free Western Blot: PDLIM7 Antibody - BSA Free [NBP1-84841]

Western Blot: PDLIM7 Antibody - BSA Free [NBP1-84841]

Analysis in human cell lines U2OS and HEK293 using Anti-PDLIM7 antibody. Corresponding PDLIM7 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
PDLIM7 Antibody - BSA Free

Western Blot: PDLIM7 Antibody - BSA Free [NBP1-84841] -

PDLIM5/7 proteins localize in the cytoplasm in dense cells but to basal stress fibers in sparse cells and bind directly to the stress fiber component alpha -actinin 1. (A) PDLIM5 localizes to the cytoplasm in dense cells but translocates, in part, to F-actin stress fibers and adherens junctions in sparsely plated cells. (B) PDLIM7 localizes to the cytoplasm in dense cells but translocates in part to F-actin stress fibers and adherens junctions in sparsely plated cells. (C) Co-immunoprecipitation of PDLIM5/7 proteins with GFP-tagged alpha -actinin 1 from human Caco2 cells. Results are representative of n=3 biological replicates. (D) Schematic diagram of YAP recruitment via the Enigma PDLIM5/7 proteins to integrin–Src signaling complexes to sense mechanical forces basally. Scale bar: 20 um (A,B). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/30404826), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for PDLIM7 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PDLIM7

PDLIM7 is encoded by this gene is representative of a family of proteins composed of conserved PDZ and LIM domains. LIM domains are proposed to function in protein-protein recognition in a variety of contexts including gene transcription and development and in cytoskeletal interaction. The LIM domains of this protein bind to protein kinases, whereas the PDZ domain binds to actin filaments. The gene product is involved in the assembly of an actin filament-associated complex essential for transmission of ret/ptc2 mitogenic signaling. The biological function is likely to be that of an adapter, with the PDZ domain localizing the LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Alternative splicing of this gene results in multiple transcript variants.

Alternate Names

1110003B01Rik, ENIGMAProtein enigma, LIM domain protein, LIM mineralization protein, LMP, LMP1, PDZ and LIM domain 7 (enigma), PDZ and LIM domain protein 7

Gene Symbol

PDLIM7

Additional PDLIM7 Products

Product Documents for PDLIM7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PDLIM7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PDLIM7 Antibody - BSA Free

Customer Reviews for PDLIM7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PDLIM7 Antibody - BSA Free and earn rewards!

Have you used PDLIM7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...