Periostin/OSF-2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82472
Loading...
Key Product Details
Validated by
Knockout/Knockdown, Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human, Mouse, Canine
Predicted:
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Immunohistochemistry-Paraffin, Western Blot, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEG
Reactivity Notes
Use in Canine reported in scientific literature (PMID: 32354887).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Periostin/OSF-2 Antibody - BSA Free
Western Blot: Periostin/OSF-2 Antibody [NBP1-82472]
Western Blot: Periostin/OSF-2 Antibody [NBP1-82472] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.Immunohistochemistry-Paraffin: Periostin/OSF-2 Antibody [NBP1-82472]
Immunohistochemistry-Paraffin: Periostin/OSF-2 Antibody [NBP1-82472] - Staining of human pancreas shows low expression as expected.Immunohistochemistry-Paraffin: Periostin/OSF-2 Antibody [NBP1-82472]
Immunohistochemistry-Paraffin: Periostin/OSF-2 Antibody [NBP1-82472] - Staining of human skin shows high expression.Immunohistochemistry: Periostin/OSF-2 Antibody [NBP1-82472] -
nbp1-82472_rabbit-periostin-osf-2-pab-20920231742123.jpgImmunohistochemistry: Periostin/OSF-2 Antibody [NBP1-82472] -
Serial sections of non-small cell lung carcinoma (NSCLC) immunostained for (A) periostin (POSTN), (B) alpha -smooth muscle actin ( alpha -SMA), (C) podoplanin (D2-40), and (D) vimentin in cancer-associated fibroblasts (CAFs). Magnification 50×. Bar = 200 µm.Western Blot: Periostin/OSF-2 Antibody [NBP1-82472] -
Western Blot: Periostin/OSF-2 Antibody [NBP1-82472] - The efficacy of shRNA lentiviral particles transfection. (A) Silencing of periostin (POSTN) expression was confirmed by Western blot analysis. beta -actin was used as an internal control. (B) Confocal images & fluorescence analysis showing the expression of POSTN in control A549.CTRL cells & A549.shRNA cells (*** p < 0.001). Objective 60×/1.40 Oil; pinhole airy 1.25. Bar = 20 µm. (C) The expression of POSTN mRNA in control cells (A549.CTRL) & the cells representing the loss-of-function phenotype (A549.shRNA). Relative expression (RQ) of the POSTN gene was normalized against the expression of ACTB (*** p < 0.001). RQ, relative quantification. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35163164), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: Periostin/OSF-2 Antibody [NBP1-82472] -
Western Blot: Periostin/OSF-2 Antibody [NBP1-82472] - Characteristics of lung cancer cell lines according to periostin (POSTN) expression. (A) Comparison of POSTN expression levels detected by Western blot & (B) by confocal microscopy (fluorescence intensity) in different lung cancer cell lines (A549, NCI-H522, NCI-H1703), (p > 0.05). Objective 60×/1.40 Oil; pinhole airy 1.25. Bar = 20 µm. (C) Immunohistochemical expression level of periostin (POSTN) in the tissue of particular non-small cell lung carcinoma (NSCLC) subtypes: squamous cell carcinoma (SCC) & adenocarcinoma (AC) (p > 0.05). IRS, immunoreactive score. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35163164), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for Periostin/OSF-2 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-P, Retrieval method: HIER pH6.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Periostin/OSF-2
Long Name
Osteoblast Specific Factor 2
Alternate Names
Fasciclin I-like, OSF-2, OSF2, POSTN, TRIF52
Gene Symbol
POSTN
UniProt
Additional Periostin/OSF-2 Products
Product Documents for Periostin/OSF-2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Periostin/OSF-2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Periostin/OSF-2 Antibody - BSA Free
Customer Reviews for Periostin/OSF-2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Periostin/OSF-2 Antibody - BSA Free and earn rewards!
Have you used Periostin/OSF-2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...