Peroxiredoxin 3 Antibody (4K7D1)

Novus Biologicals | Catalog # NBP3-16125

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4K7D1 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 157-256 of human Peroxiredoxin 3 (PRDX3) (P30048). NIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Peroxiredoxin 3 Antibody (4K7D1)

Western Blot: Peroxiredoxin 3 Antibody (4K7D1) [NBP3-16125]

Western Blot: Peroxiredoxin 3 Antibody (4K7D1) [NBP3-16125]

Western Blot: Peroxiredoxin 3 Antibody (4K7D1) [NBP3-16125] - Western blot analysis of extracts of various cell lines, using Peroxiredoxin 3 (PRDX3) Rabbit mAb (NBP3-16125) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Peroxiredoxin 3 Antibody (4K7D1)

Immunohistochemistry: Peroxiredoxin 3 Antibody (4K7D1) [NBP3-16125] -

Immunohistochemistry: Peroxiredoxin 3 Antibody (4K7D1) [NBP3-16125] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using Peroxiredoxin 3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Peroxiredoxin 3 Antibody (4K7D1)

Immunocytochemistry/ Immunofluorescence: Peroxiredoxin 3 Antibody (4K7D1) [NBP3-16125] -

Immunocytochemistry/ Immunofluorescence: Peroxiredoxin 3 Antibody (4K7D1) [NBP3-16125] - Confocal imaging of U-2 OS cells using Peroxiredoxin 3 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Peroxiredoxin 3 Antibody (4K7D1)

Immunohistochemistry: Peroxiredoxin 3 Antibody (4K7D1) [NBP3-16125] -

Immunohistochemistry: Peroxiredoxin 3 Antibody (4K7D1) [NBP3-16125] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Peroxiredoxin 3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for Peroxiredoxin 3 Antibody (4K7D1)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Peroxiredoxin 3

The peroxiredoxin (PRX) family comprises six antioxidant proteins, PRX I, II, III, IV, V and VI, which protect cells from reactive oxygen species (ROS) by preventing the metal-catalyzed oxidation of enzymes. The PRX proteins primarily utilize thioredoxin as the electron donor for antioxidation, although they are fairly promiscuous with regard to the hydroperoxide substrate. In addition to protection from ROS, peroxiredoxins are also involved in cell proliferation, differentiation and gene expression. PRX I, II, IV and VI show diffuse cytoplasmic localization, while PRX III and V exhibit distinct mitochondrial localization. The human PRX I gene encodes a protein that is expressed in several tissues, including liver, kidney, testis, lung and nervous system. PRX II is expressed in testis, while PRX III shows expression in lung. PRX I, II and III are overexpressed in breast cancer and may be involved in its development or progression. Upregulated protein levels of PRX I and II in Alzheimer's disease (AD) and Down syndrome (DS) indicate the involvement of PRX I and II in their pathogenesis.

Alternate Names

AOP-1, MER5, PRDX3, SP-22

Gene Symbol

PRDX3

Additional Peroxiredoxin 3 Products

Product Documents for Peroxiredoxin 3 Antibody (4K7D1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Peroxiredoxin 3 Antibody (4K7D1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Peroxiredoxin 3 Antibody (4K7D1)

There are currently no reviews for this product. Be the first to review Peroxiredoxin 3 Antibody (4K7D1) and earn rewards!

Have you used Peroxiredoxin 3 Antibody (4K7D1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...