Peroxiredoxin 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38486

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSCHAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Peroxiredoxin 3 Antibody - BSA Free

Western Blot: Peroxiredoxin 3 Antibody [NBP2-38486]

Western Blot: Peroxiredoxin 3 Antibody [NBP2-38486]

Western Blot: Peroxiredoxin 3 Antibody [NBP2-38486] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Peroxiredoxin 3 Antibody - BSA Free Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486]

Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486]

Analysis in human liver and skin tissues. Corresponding RNA-seq data are presented for the same tissues.
Peroxiredoxin 3 Antibody - BSA Free Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486]

Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486]

Staining of human skin shows negative to very weak cytoplasmic granular positivity in squamous epithelial cells as expected.
Peroxiredoxin 3 Antibody - BSA Free Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486]

Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486]

Staining of human kidney shows strong cytoplasmic granular positivity in cells in tubules.
Peroxiredoxin 3 Antibody - BSA Free Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486]

Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486]

Staining of human liver shows strong cytoplasmic granular positivity in hepatocytes.
Peroxiredoxin 3 Antibody - BSA Free Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486]

Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486]

Staining of human placenta shows strong cytoplasmic granular positivity in trophoblastic cells.

Applications for Peroxiredoxin 3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Peroxiredoxin 3

The peroxiredoxin (PRX) family comprises six antioxidant proteins, PRX I, II, III, IV, V and VI, which protect cells from reactive oxygen species (ROS) by preventing the metal-catalyzed oxidation of enzymes. The PRX proteins primarily utilize thioredoxin as the electron donor for antioxidation, although they are fairly promiscuous with regard to the hydroperoxide substrate. In addition to protection from ROS, peroxiredoxins are also involved in cell proliferation, differentiation and gene expression. PRX I, II, IV and VI show diffuse cytoplasmic localization, while PRX III and V exhibit distinct mitochondrial localization. The human PRX I gene encodes a protein that is expressed in several tissues, including liver, kidney, testis, lung and nervous system. PRX II is expressed in testis, while PRX III shows expression in lung. PRX I, II and III are overexpressed in breast cancer and may be involved in its development or progression. Upregulated protein levels of PRX I and II in Alzheimer's disease (AD) and Down syndrome (DS) indicate the involvement of PRX I and II in their pathogenesis.

Alternate Names

AOP-1, MER5, PRDX3, SP-22

Gene Symbol

PRDX3

UniProt

Additional Peroxiredoxin 3 Products

Product Documents for Peroxiredoxin 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Peroxiredoxin 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Peroxiredoxin 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Peroxiredoxin 3 Antibody - BSA Free and earn rewards!

Have you used Peroxiredoxin 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...