Peroxiredoxin 4 Antibody (9E7V0)

Novus Biologicals | Catalog # NBP3-16760

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9E7V0 expressed in HEK293
View all Peroxiredoxin 4 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Peroxiredoxin 4 (PRDX4) (Q13162). MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Peroxiredoxin 4 Antibody (9E7V0)

Western Blot: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760]

Western Blot: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760]

Western Blot: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Western blot analysis of extracts of various cell lines, using Peroxiredoxin 4 (PRDX4) Rabbit mAb (NBP3-16760) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Immunocytochemistry/ Immunofluorescence: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760]

Immunocytochemistry/ Immunofluorescence: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760]

Immunocytochemistry/Immunofluorescence: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunofluorescence analysis of NIH-3T3 cells using Peroxiredoxin 4 (PRDX4) Rabbit mAb (NBP3-16760) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Peroxiredoxin 4 Antibody (9E7V0)

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] -

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunohistochemistry analysis of Peroxiredoxin 4 in paraffin-embedded human cervix cancer tissue using Peroxiredoxin 4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Peroxiredoxin 4 Antibody (9E7V0)

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] -

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunohistochemistry analysis of Peroxiredoxin 4 in paraffin-embedded mouse testis tissue using Peroxiredoxin 4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Peroxiredoxin 4 Antibody (9E7V0)

Immunocytochemistry/ Immunofluorescence: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] -

Immunocytochemistry/ Immunofluorescence: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunofluorescence analysis of NIH-3T3 cells using Peroxiredoxin 4 (PRDX4) Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Peroxiredoxin 4 Antibody (9E7V0)

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] -

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunohistochemistry analysis of Peroxiredoxin 4 in paraffin-embedded human liver tissue using Peroxiredoxin 4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Peroxiredoxin 4 Antibody (9E7V0)

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] -

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunohistochemistry analysis of Peroxiredoxin 4 in paraffin-embedded human thyroid cancer tissue using Peroxiredoxin 4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Peroxiredoxin 4 Antibody (9E7V0)

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] -

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunohistochemistry analysis of Peroxiredoxin 4 in paraffin-embedded human lung cancer tissue using Peroxiredoxin 4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Peroxiredoxin 4 Antibody (9E7V0)

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] -

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunohistochemistry analysis of Peroxiredoxin 4 in paraffin-embedded rat colon tissue using Peroxiredoxin 4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Peroxiredoxin 4 Antibody (9E7V0)

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] -

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunohistochemistry analysis of Peroxiredoxin 4 in paraffin-embedded human colon carcinoma tissue using Peroxiredoxin 4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for Peroxiredoxin 4 Antibody (9E7V0)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Peroxiredoxin 4

Peroxiredoxin-4 is encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB.

Alternate Names

AOE372, PRDX4, Prx4

Gene Symbol

PRDX4

Additional Peroxiredoxin 4 Products

Product Documents for Peroxiredoxin 4 Antibody (9E7V0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Peroxiredoxin 4 Antibody (9E7V0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Oxidative Stress
Redox Enzymes

Customer Reviews for Peroxiredoxin 4 Antibody (9E7V0)

There are currently no reviews for this product. Be the first to review Peroxiredoxin 4 Antibody (9E7V0) and earn rewards!

Have you used Peroxiredoxin 4 Antibody (9E7V0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies