PGAM5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92257

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (94%), Rat (92%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western, Knockdown Validated

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PGAM5 Antibody - BSA Free

Western Blot: PGAM5 Antibody [NBP1-92257]

Western Blot: PGAM5 Antibody [NBP1-92257]

Western Blot: PGAM5 Antibody [NBP1-92257] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257]

Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257]

Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human colon, liver, testis and tonsil using Anti-PGAM5 antibody NBP1-92257 (A) shows similar protein distribution across tissues to independent antibody NBP1-92258 (B).
Immunocytochemistry/ Immunofluorescence: PGAM5 Antibody [NBP1-92257]

Immunocytochemistry/ Immunofluorescence: PGAM5 Antibody [NBP1-92257]

Immunocytochemistry/Immunofluorescence: PGAM5 Antibody [NBP1-92257] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257]

Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257]

Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257]

Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257]

Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257]

Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257]

Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human tonsil shows moderate granular cytoplasmic positivity in germinal center cells
Simple Western: PGAM5 Antibody [NBP1-92257]

Simple Western: PGAM5 Antibody [NBP1-92257]

Simple Western: PGAM5 Antibody [NBP1-92257] - Simple Western lane view shows a specific band for PGAM5 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: PGAM5 Antibody [NBP1-92257]

Simple Western: PGAM5 Antibody [NBP1-92257]

Simple Western: PGAM5 Antibody [NBP1-92257] - Electropherogram image(s) of corresponding Simple Western lane view. PGAM5 antibody was used at 1:60 dilution on RT-4 lysate(s).
PGAM5 Antibody

Western Blot: Rabbit Polyclonal PGAM5 Antibody [NBP1-92257] -

Western Blot: Rabbit Polyclonal PGAM5 Antibody [NBP1-92257] - Whole cell lysates from MDA-MB-231, SUM159 and MCF-7 cells were loaded with 50 ug/lane. 10% SDS-PAGE. PGAM5 Antibody (NBP1-92257) was used for primary antibody: 1:1000, 4C, overnight. Image from a verified customer review.
PGAM5 Antibody - BSA Free Immunohistochemistry: PGAM5 Antibody - BSA Free [NBP1-92257]

Immunohistochemistry: PGAM5 Antibody - BSA Free [NBP1-92257]

Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
PGAM5 Antibody - BSA Free Immunohistochemistry: PGAM5 Antibody - BSA Free [NBP1-92257]

Immunohistochemistry: PGAM5 Antibody - BSA Free [NBP1-92257]

Staining of human colon shows moderate granular cytoplasmic positivity in glandular cells.
PGAM5 Antibody - BSA Free Western Blot: PGAM5 Antibody - BSA Free [NBP1-92257]

Western Blot: PGAM5 Antibody - BSA Free [NBP1-92257]

Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-PPIB.
PGAM5 Antibody - BSA Free Immunohistochemistry: PGAM5 Antibody - BSA Free [NBP1-92257]

Immunohistochemistry: PGAM5 Antibody - BSA Free [NBP1-92257]

Staining of human tonsil shows moderate granular cytoplasmic positivity in germinal center cells.

Applications for PGAM5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Simple Western

1:60

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, separated by Size, antibody dilution of 1:60, apparent MW was 38 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Reviewed Applications

Read 1 review rated 5 using NBP1-92257 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PGAM5

Displays phosphatase activity for serine/threonine residues, and, dephosphorylates and activates MAP3K5kinase. Has apparently no phosphoglycerate mutase activity. May be regulator of mitochondrial dynamics. Substrate fora Keap1-dependent ubiquitin ligase complex. Contributes to the repression of NFE2L2-dependent gene expression

Alternate Names

Bcl-XL-binding protein v68, BXLBv68, EC 3.1.3.16, MGC5352, phosphoglycerate mutase family member 5BXLBV68, serine/threonine-protein phosphatase PGAM5, mitochondrial

Entrez Gene IDs

192111 (Human)

Gene Symbol

PGAM5

UniProt

Additional PGAM5 Products

Product Documents for PGAM5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PGAM5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PGAM5 Antibody - BSA Free

Customer Reviews for PGAM5 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used PGAM5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • PGAM5 Antibody
    Name: Yongkang Yang
    Application: Western Blot
    Verified Customer | Posted 12/20/2023
    Western Blot: whole cell lysates from MDA-MB-231, SUM159 and MCF-7 cells were loaded with 50 ug/lane. 10% SDS-PAGE. PGAM5 Antibody (NBP1-92257) was used for primary antibody: 1:1000, 4℃, overnight.
    PGAM5 Antibody - BSA Free NBP1-92257

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PGAM5 Antibody - BSA Free

Showing  1 - 2 of 2 FAQs Showing All
  • Q: Could you please tell me the concentration of your anti-PGAM5 antibody NBP1-92257? It was purchased on 5-14-13. Our batch has been aliquoted, so we no longer have the original tube with the concentration and lot#.

    A: Our current lot of this antibody is at 0.3 mg/mL. It looks like you may have received a previous lot and I have emailed the lab for the concentration of that lot. It is most likely very close to the concentration of the current lot though. If you need to proceed with your studies immediately, I would recommend assuming that your lot is close to 0.3 mg/mL. I have confirmed that the concentration of the lot I suspect you received is also 0.3 mg/mL.

  • Q: I am interested in PGAM5 antibody (NBP1-92257) for use in mouse cells. However, as described in the information on the website and in the data sheet, the reactivity is only for human cells. Furthermore, the images of the western-blot show many nonspecific bands. I wonder if you may send me a small sample of this antibody to test the reactivity of mouse cell lines? If possible, I could test reactivity of its antibody and send images and optimized protocol. Can you please let the customer know the cross reactivity % for this?

    A: The cross reactivity with mouse is 94% and rat is 92% however because we have not tested it we can't guarantee it. As per company policy, we do not provide free samples; however, we do have a program that may be of interest to you called Innovators Reward Program.

  • Q: Could you please tell me the concentration of your anti-PGAM5 antibody NBP1-92257? It was purchased on 5-14-13. Our batch has been aliquoted, so we no longer have the original tube with the concentration and lot#.

    A: Our current lot of this antibody is at 0.3 mg/mL. It looks like you may have received a previous lot and I have emailed the lab for the concentration of that lot. It is most likely very close to the concentration of the current lot though. If you need to proceed with your studies immediately, I would recommend assuming that your lot is close to 0.3 mg/mL. I have confirmed that the concentration of the lot I suspect you received is also 0.3 mg/mL.

  • Q: I am interested in PGAM5 antibody (NBP1-92257) for use in mouse cells. However, as described in the information on the website and in the data sheet, the reactivity is only for human cells. Furthermore, the images of the western-blot show many nonspecific bands. I wonder if you may send me a small sample of this antibody to test the reactivity of mouse cell lines? If possible, I could test reactivity of its antibody and send images and optimized protocol. Can you please let the customer know the cross reactivity % for this?

    A: The cross reactivity with mouse is 94% and rat is 92% however because we have not tested it we can't guarantee it. As per company policy, we do not provide free samples; however, we do have a program that may be of interest to you called Innovators Reward Program.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Antibodies
Loading...