PKC delta Antibody (7I5U6)

Novus Biologicals | Catalog # NBP3-16660

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7I5U6 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 547-653 of human PKC delta (Q05655). PFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLID

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PKC delta Antibody (7I5U6)

Western Blot: PKC delta Antibody (7I5U6) [NBP3-16660]

Western Blot: PKC delta Antibody (7I5U6) [NBP3-16660]

Western Blot: PKC delta Antibody (7I5U6) [NBP3-16660] - Western blot analysis of extracts of various cell lines, using PKC delta Rabbit mAb (NBP3-16660) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
PKC delta Antibody (7I5U6)

Immunohistochemistry: PKC delta Antibody (7I5U6) [NBP3-16660] -

Immunohistochemistry: PKC delta Antibody (7I5U6) [NBP3-16660] - Immunohistochemistry analysis of PKC delta in paraffin-embedded human thyroid tissue using PKC delta Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
PKC delta Antibody (7I5U6)

Immunohistochemistry: PKC delta Antibody (7I5U6) [NBP3-16660] -

Immunohistochemistry: PKC delta Antibody (7I5U6) [NBP3-16660] - Immunohistochemistry analysis of PKC delta in paraffin-embedded mouse brain tissue using PKC delta Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
PKC delta Antibody (7I5U6)

Immunocytochemistry/ Immunofluorescence: PKC delta Antibody (7I5U6) [NBP3-16660] -

Immunocytochemistry/ Immunofluorescence: PKC delta Antibody (7I5U6) [NBP3-16660] - Immunofluorescence analysis of NIH-3T3 cells using PKC delta Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
PKC delta Antibody (7I5U6)

Immunohistochemistry: PKC delta Antibody (7I5U6) [NBP3-16660] -

Immunohistochemistry: PKC delta Antibody (7I5U6) [NBP3-16660] - Immunohistochemistry analysis of PKC delta in paraffin-embedded human spleen tissue using PKC delta Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
PKC delta Antibody (7I5U6)

Immunohistochemistry: PKC delta Antibody (7I5U6) [NBP3-16660] -

Immunohistochemistry: PKC delta Antibody (7I5U6) [NBP3-16660] - Immunohistochemistry analysis of PKC delta in paraffin-embedded mouse colon tissue using PKC delta Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
PKC delta Antibody (7I5U6)

Immunohistochemistry: PKC delta Antibody (7I5U6) [NBP3-16660] -

Immunohistochemistry: PKC delta Antibody (7I5U6) [NBP3-16660] - Immunohistochemistry analysis of PKC delta in paraffin-embedded mouse testis tissue using PKC delta Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for PKC delta Antibody (7I5U6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PKC delta

PKC-delta has a biological activity which is closely related to Pkc1, and PKC-delta activates the Pkc1-mediated pathway through an activation of the Bck1 kinase. PKC-delta appears to play a critical role in growth control of yeast and mammalian cells. Suppression experiments suggest that PKC-delta desensitizes the pathway by regulating an aspect of G protein function (1). PKC-delta phosphorylates hRad9 in vitro and in cells exposed to genotoxic agents. It has been shown that PKC-delta is required for binding of hRad9 to Bcl-2. In concert with these results, inhibition of PKC-delta attenuates Rad9-mediated apoptosis. These findings demonstrate that PKC-delta is responsible for the regulation of Rad9 in the Hus1-Rad1 complex and in the apoptotic response to DNA damage (2). It has been reported a mechanism for the regulation of peripheral B-cell survival by serine/threonine protein kinase Cdelta (PKC-delta): spontaneous death of resting B cells is regulated by nuclear localization of PKC-delta that contributes to phosphorylation of histone H2B at serine 14 (S14-H2B) (3).

Long Name

Protein Kinase C delta

Alternate Names

PRKCD

Gene Symbol

PRKCD

Additional PKC delta Products

Product Documents for PKC delta Antibody (7I5U6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PKC delta Antibody (7I5U6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PKC delta Antibody (7I5U6)

There are currently no reviews for this product. Be the first to review PKC delta Antibody (7I5U6) and earn rewards!

Have you used PKC delta Antibody (7I5U6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies