PKC delta Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90351

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSFGKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDH

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PKC delta Antibody - BSA Free

Immunohistochemistry-Paraffin: PKC delta Antibody [NBP1-90351]

Immunohistochemistry-Paraffin: PKC delta Antibody [NBP1-90351]

Immunohistochemistry-Paraffin: PKC delta Antibody [NBP1-90351] - Staining of human prostate, skeletal muscle, tonsil and upper gastrointestinal using Anti-PKC delta antibody NBP1-90351 (A) shows similar protein distribution across tissues to independent antibody NBP1-90957 (B).
Immunohistochemistry-Paraffin: PKC delta Antibody [NBP1-90351]

Immunohistochemistry-Paraffin: PKC delta Antibody [NBP1-90351]

Immunohistochemistry-Paraffin: PKC delta Antibody [NBP1-90351] - Analysis in human tonsil and skeletal muscle tissues. Corresponding PKC delta RNA-seq data are presented for the same tissues.
PKC delta Antibody - BSA Free Immunohistochemistry: PKC delta Antibody - BSA Free [NBP1-90351]

Immunohistochemistry: PKC delta Antibody - BSA Free [NBP1-90351]

Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.
PKC delta Antibody - BSA Free Immunohistochemistry: PKC delta Antibody - BSA Free [NBP1-90351]

Immunohistochemistry: PKC delta Antibody - BSA Free [NBP1-90351]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: PKC delta Antibody [NBP1-90351]

Immunohistochemistry-Paraffin: PKC delta Antibody [NBP1-90351]

Immunohistochemistry-Paraffin: PKC delta Antibody [NBP1-90351] - Staining of human duodenum shows weak to moderate cytoplasmic positivity in glandular cells.
PKC delta Antibody - BSA Free Immunohistochemistry: PKC delta Antibody - BSA Free [NBP1-90351]

Immunohistochemistry: PKC delta Antibody - BSA Free [NBP1-90351]

Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
PKC delta Antibody - BSA Free Western Blot: PKC delta Antibody - BSA Free [NBP1-90351]

Western Blot: PKC delta Antibody - BSA Free [NBP1-90351]

Analysis in control (vector only transfected HEK293T lysate) and PRKCD over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
PKC delta Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: PKC delta Antibody [NBP1-90351]

Immunocytochemistry/ Immunofluorescence: PKC delta Antibody [NBP1-90351]

Staining of human cell line U-2 OS shows localization to cytosol.

Applications for PKC delta Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PKC delta

PKC-delta has a biological activity which is closely related to Pkc1, and PKC-delta activates the Pkc1-mediated pathway through an activation of the Bck1 kinase. PKC-delta appears to play a critical role in growth control of yeast and mammalian cells. Suppression experiments suggest that PKC-delta desensitizes the pathway by regulating an aspect of G protein function (1). PKC-delta phosphorylates hRad9 in vitro and in cells exposed to genotoxic agents. It has been shown that PKC-delta is required for binding of hRad9 to Bcl-2. In concert with these results, inhibition of PKC-delta attenuates Rad9-mediated apoptosis. These findings demonstrate that PKC-delta is responsible for the regulation of Rad9 in the Hus1-Rad1 complex and in the apoptotic response to DNA damage (2). It has been reported a mechanism for the regulation of peripheral B-cell survival by serine/threonine protein kinase Cdelta (PKC-delta): spontaneous death of resting B cells is regulated by nuclear localization of PKC-delta that contributes to phosphorylation of histone H2B at serine 14 (S14-H2B) (3).

Long Name

Protein Kinase C delta

Alternate Names

PRKCD

Gene Symbol

PRKCD

Additional PKC delta Products

Product Documents for PKC delta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PKC delta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PKC delta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PKC delta Antibody - BSA Free and earn rewards!

Have you used PKC delta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies