PKC epsilon Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38531

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PKC epsilon Antibody - BSA Free

Western Blot: PKC epsilon Antibody [NBP2-38531]

Western Blot: PKC epsilon Antibody [NBP2-38531]

Western Blot: PKC epsilon Antibody [NBP2-38531] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunohistochemistry-Paraffin: PKC epsilon Antibody [NBP2-38531]

Immunohistochemistry-Paraffin: PKC epsilon Antibody [NBP2-38531]

Immunohistochemistry-Paraffin: PKC epsilon Antibody [NBP2-38531] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: PKC epsilon Antibody [NBP2-38531]

Immunohistochemistry-Paraffin: PKC epsilon Antibody [NBP2-38531]

Immunohistochemistry-Paraffin: PKC epsilon Antibody [NBP2-38531] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuropil and neuronal cells.
Immunohistochemistry-Paraffin: PKC epsilon Antibody [NBP2-38531]

Immunohistochemistry-Paraffin: PKC epsilon Antibody [NBP2-38531]

Immunohistochemistry-Paraffin: PKC epsilon Antibody [NBP2-38531] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: PKC epsilon Antibody [NBP2-38531]

Immunohistochemistry-Paraffin: PKC epsilon Antibody [NBP2-38531]

Immunohistochemistry-Paraffin: PKC epsilon Antibody [NBP2-38531] - Staining in human cerebral cortex and pancreas tissues using anti-PRKCE antibody. Corresponding PRKCE RNA-seq data are presented for the same tissues.

Applications for PKC epsilon Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PKC epsilon

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This kinase has been shown to be involved in many different cellular functions, such as neuron channel activation, apoptosis, cardioprotection from ischemia, heat shock response, as well as insulin exocytosis. Knockout studies in mice suggest that this kinase is important for lipopolysaccharide (LPS)-mediated signaling in activated macrophages and may also play a role in controlling anxiety-like behavior.

Long Name

Protein Kinase C epsilon

Alternate Names

PKCE, PRKCE

Gene Symbol

PRKCE

UniProt

Additional PKC epsilon Products

Product Documents for PKC epsilon Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PKC epsilon Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for PKC epsilon Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PKC epsilon Antibody - BSA Free and earn rewards!

Have you used PKC epsilon Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies